OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HS2ST1 (NM_012262) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC223657
HS2ST1 (Myc-DDK-tagged)-Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA300103 HS2ST1 Antibody (N-term)
400 ul
$645.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HS2ST1 or NM_012262"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HS2ST1
Synonyms dJ604K5.2; NFSRA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223657 representing NM_012262
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGCTCCTCAGGATTATGATGCCGCCCAAGTTGCAGCTGCTGGCGGTGGTGGCCTTCGCGGTGGCGA
TGCTCTTCTTGGAAAACCAGATCCAGAAACTGGAGGAGTCCCGCTCGAAGCTAGAAAGGGCTATTGCAAG
ACACGAAGTCCGAGAAATTGAGCAGCGACATACAATGGATGGCCCTCGGCAAGATGCCACTTTAGATGAG
GAAGAGGACATGGTGATCATTTATAACAGAGTTCCCAAAACGGCAAGCACTTCATTTACCAATATCGCCT
ATGACCTGTGTGCAAAGAATAAATACCATGTCCTTCATATCAACACTACCAAAAATAATCCAGTGATGTC
ATTGCAAGATCAGGTGCGCTTTGTAAAGAATATAACTTCCTGGAAAGAGATGAAACCAGGATTTTATCAT
GGACACGTTTCTTACTTGGATTTTGCAAAATTTGGTGTGAAGAAGAAACCAATTTACATTAATGTCATAA
GGGATCCTATTGAGAGGCTAGTTTCTTATTATTACTTTCTGAGATTTGGAGATGATTATAGACCAGGGTT
ACGGAGACGAAAACAAGGAGACAAAAAGACCTTTGATGAATGTGTAGCAGAAGGTGGCTCAGACTGTGCT
CCAGAGAAGCTCTGGCTTCAAATCCCGTTCTTCTGTGGCCATAGCTCCGAATGCTGGAATGTGGGAAGCA
GGTGGGCTATGGATCAAGCCAAGTATAACCTAATTAATGAATATTTTCTGGTGGGAGTTACTGAAGAACT
TGAAGATTTTATCATGTTATTGGAGGCAGCATTGCCCCGGTTTTTCAGGGGTGCTACTGAACTCTATCGC
ACAGGAAAGAAATCTCATCTTAGGAAAACCACAGAGAAGAAACTCCCCACTAAACAAACCATTGCAAAAC
TACAGCAATCTGATATTTGGAAAATGGAGAATGAGTTCTATGAATTTGCACTAGAGCAGTTCCAATTCAT
CAGAGCCCATGCCGTTCGAGAAAAAGATGGAGACCTCTACATCCTCGCACAAAACTTTTTCTATGAAAAG
ATTTACCCTAAGTCGAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC223657 representing NM_012262
Red=Cloning site Green=Tags(s)

MGLLRIMMPPKLQLLAVVAFAVAMLFLENQIQKLEESRSKLERAIARHEVREIEQRHTMDGPRQDATLDE
EEDMVIIYNRVPKTASTSFTNIAYDLCAKNKYHVLHINTTKNNPVMSLQDQVRFVKNITSWKEMKPGFYH
GHVSYLDFAKFGVKKKPIYINVIRDPIERLVSYYYFLRFGDDYRPGLRRRKQGDKKTFDECVAEGGSDCA
PEKLWLQIPFFCGHSSECWNVGSRWAMDQAKYNLINEYFLVGVTEELEDFIMLLEAALPRFFRGATELYR
TGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQNFFYEK
IYPKSN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012262
ORF Size 1068 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012262.4
RefSeq Size 6708 bp
RefSeq ORF 1071 bp
Locus ID 9653
UniProt ID Q7LGA3
Cytogenetics 1p22.3
Domains HS2ST
Protein Pathways Heparan sulfate biosynthesis
MW 41.7 kDa
Summary Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation. Two alternatively spliced transcript variants that encode different proteins have been found for this gene. provided by RefSeq, Aug 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012262" in other vectors (6)
SKU Description Size Price
RC223657L1 Lenti ORF clone of Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC223657L2 Lenti ORF clone of Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1, mGFP tagged 10 ug
$757.00
RC223657L3 Lenti ORF clone of Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC223657L4 Lenti ORF clone of Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG223657 HS2ST1 (tGFP-tagged) - Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1 10 ug
$489.00 $657.00
SC115469 HS2ST1 (untagged)-Human heparan sulfate 2-O-sulfotransferase 1 (HS2ST1), transcript variant 1 10 ug
$457.00

Plasmid Map for RC223657

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC223657
Circular map for RC223657

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products