OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TRF2 (TERF2) (NM_005652) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC223601
TERF2 (Myc-DDK-tagged)-Human telomeric repeat binding factor 2 (TERF2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
$289.00 $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA336371 Mouse Monoclonal TRF-2 Antibody (4A794.15)
100 ug
$670.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "TRF2 or NM_005652"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol TRF2
Synonyms TRBF2; TRF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC223601 representing NM_005652
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGAGGAGGCGGGAGTAGCGACGGCAGCGGGCGGGCAGCTGGCAGGCGGGCGTCCCGCAGTAGCG
GGCGGGCCCGGCGGGGGCGCCACGAGCCGGGGCTGGGGGGCCCGGCGGAGCGCGGCGCGGGGGAGGCACG
GCTGGAAGAGGCAGTCAATCGCTGGGTGCTCAAGTTCTACTTCCACGAGGCGCTGCGGGCCTTTCGGGGT
AGCCGGTACGGGGACTTCAGACAGATCCGGGACATCATGCAGGCTTTGCTTGTCAGGCCCTTGGGGAAGG
AGCACACCGTGTCCCGATTGCTGCGGGTTATGCAGTGTCTGTCGCGGATTGAAGAAGGGGAAAATTTAGA
CTGTTCCTTTGATATGGAGGCTGAGCTCACACCACTGGAATCAGCTATCAATGTGCTGGAGATGATTAAA
ACGGAATTTACACTGACAGAAGCAGTGGTCGAATCCAGTAGAAAACTGGTCAAGGAAGCTGCTGTCATTA
TTTGTATCAAAAACAAAGAATTTGAAAAGGCTTCAAAAATTTTGAAAAAACATATGTCCAAGGACCCCAC
AACTCAGAAGCTGAGAAATGATCTCCTGAATATTATTCGAGAAAAGAACTTGGCCCATCCTGTTATCCAG
AACTTTTCATATGAGACCTTCCAGCAGAAGATGCTGCGCTTCCTGGAGAGCCACCTGGATGACGCCGAGC
CCTACCTCCTCACGATGGCCAAAAAGGCTTTGAAATCTGAGTCCGCTGCCTCAAGTACAGGGAAGGAAGA
TAAACAGCCAGCACCAGGGCCTGTGGAAAAGCCACCCAGAGAACCCGCAAGGCAGCTACGGAATCCTCCA
ACCACCATTGGAATGATGACTCTGAAAGCAGCTTTCAAGACTCTGTCTGGTGCACAGGATTCTGAGGCAG
CCTTTGCAAAACTGGACCAGAAGGATCTGGTTCTTCCTACTCAAGCTCTCCCAGCATCACCAGCCCTCAA
AAACAAGAGACCCAGAAAAGATGAAAACGAAAGTTCAGCCCCGGCTGACGGTGAGGGTGGCTCGGAACTG
CAGCCCAAGAACAAGCGCATGACAATAAGCAGATTGGTCTTGGAGGAGGACAGCCAGAGTACTGAGCCCA
GCGCAGGCCTCAACTCCTCCCAGGAGGCCGCTTCAGCGCCACCATCCAAGCCCACCGTTCTCAACCAACC
CCTCCCTGGAGAGAAGAATCCCAAAGTACCCAAAGGCAAGTGGAACAGCTCTAATGGGGTTGAAGAAAAG
GAGACTTGGGTGGAAGAGGATGAACTGTTTCAAGTTCAGGCAGCACCAGATGAAGACAGTACAACCAATA
TAACAAAAAAGCAGAAGTGGACTGTAGAAGAAAGCGAGTGGGTCAAGGCTGGAGTGCAGAAATATGGGGA
AGGAAACTGGGCTGCCATTTCTAAAAATTACCCATTTGTTAACCGAACAGCTGTGATGATTAAGGATCGC
TGGCGGACCATGAAAAGACTTGGCATGAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC223601 representing NM_005652
Red=Cloning site Green=Tags(s)

MAGGGGSSDGSGRAAGRRASRSSGRARRGRHEPGLGGPAERGAGEARLEEAVNRWVLKFYFHEALRAFRG
SRYGDFRQIRDIMQALLVRPLGKEHTVSRLLRVMQCLSRIEEGENLDCSFDMEAELTPLESAINVLEMIK
TEFTLTEAVVESSRKLVKEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRNDLLNIIREKNLAHPVIQ
NFSYETFQQKMLRFLESHLDDAEPYLLTMAKKALKSESAASSTGKEDKQPAPGPVEKPPREPARQLRNPP
TTIGMMTLKAAFKTLSGAQDSEAAFAKLDQKDLVLPTQALPASPALKNKRPRKDENESSAPADGEGGSEL
QPKNKRMTISRLVLEEDSQSTEPSAGLNSSQEAASAPPSKPTVLNQPLPGEKNPKVPKGKWNSSNGVEEK
ETWVEEDELFQVQAAPDEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDR
WRTMKRLGMN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005652
ORF Size 1500 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005652.3
RefSeq Size 2909 bp
RefSeq ORF 1629 bp
Locus ID 7014
UniProt ID Q15554
Cytogenetics 16q22.1
Domains myb_DNA-binding
Protein Families Transcription Factors
MW 55.4 kDa
Summary This gene encodes a telomere specific protein, TERF2, which is a component of the telomere nucleoprotein complex. This protein is present at telomeres in metaphase of the cell cycle, is a second negative regulator of telomere length and plays a key role in the protective activity of telomeres. While having similar telomere binding activity and domain organization, TERF2 differs from TERF1 in that its N terminus is basic rather than acidic. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005652" in other vectors (6)
SKU Description Size Price
RC223601L1 Lenti-ORF clone of TERF2 (Myc-DDK-tagged)-Human telomeric repeat binding factor 2 (TERF2) 10 ug
$757.00
RC223601L2 Lenti-ORF clone of TERF2 (mGFP-tagged)-Human telomeric repeat binding factor 2 (TERF2) 10 ug
$757.00
RC223601L3 Lenti-ORF clone of TERF2 (Myc-DDK-tagged)-Human telomeric repeat binding factor 2 (TERF2) 10 ug
$757.00
RC223601L4 Lenti-ORF clone of TERF2 (mGFP-tagged)-Human telomeric repeat binding factor 2 (TERF2) 10 ug
$757.00
RG223601 TERF2 (tGFP-tagged) - Human telomeric repeat binding factor 2 (TERF2) 10 ug
$489.00 $657.00
SC116614 TERF2 (untagged)-Human telomeric repeat binding factor 2 (TERF2) 10 ug
$466.00

Plasmid Map for RC223601

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC223601
Circular map for RC223601

file-alt Citations

Telomere length sensitive regulation of interleukin receptor 1 type 1 (IL1R1) by the shelterin protein TRF2 modulates immune signalling in the tumour microenvironment
Mukherjee, Dutta, Singh et al
Elife (2024) 13 DOI: 10.7554/eLife.95106
AI Summary: OriGene products contributed to this study by providing the pCMV6-myc-DDK(FLAG)-TRF2 vector (RC223601) for TRF2 overexpression and TRF2 shRNA plasmid (TL308880) for TRF2 knockdown, enabling the authors to investigate the role of TRF2 in telomere length-dependent regulation of IL1R1 and immune signalling in cancer.
Snippet: l (1:100) Antibody Anti-mouse IgG (mouse polyclonal) Millipore (Millipore 12–371) isotype control (1:100) Recombinant DNA reagent pCMV6-myc-DDK(FLAG)-TRF2 vector (TRF2 WT) origene RC223601 Plasmid Recombinant DNA reagent TRF2 shRNA origene TL308880 Plasmid Recombinant DNA reagent dCAS9-VP64-GFP Addgene 61422 Plasmid Recombinant
FigureFigureFigure
Telomere repeat-binding factor 2 binds extensively to extra-telomeric G-quadruplexes and regulates the epigenetic status of several gene promoters
Mukherjee, Sharma, Bagri et al
J. Biol. Chem. (2019) 294 (47), 17709-17722 DOI: 10.1074/jbc.RA119.008687
AI Summary: OriGene contributed to this study by providing the pCMV6-myc-DDK (FLAG)-TRF2 expression vector (RC223601), which was used to investigate the role of TRF2 in binding to extra-telomeric G-quadruplexes and regulating gene promoter epigenetic status.
Snippet: was received as a gift from Dr Giraud Panis, CNRS, France. The pCMV6-myc-DDK( FLAG)- TRF2 vector was procured from Origene (RC223601). The mutants delB and delM constructs used in the study have been previously reported(19). TRF2 shRNA was procured
Extratelomeric Binding of the Telomere Binding Protein TRF2 at the PCGF3 Promoter Is G-Quadruplex Motif-Dependent
Purohit, Mukherjee, Sharma et al
Biochemistry (2018) 57 (16), 2317-2324 DOI: 10.1021/acs.biochem.8b00019
AI Summary: OriGene provided the pCMV6-TRF2, pCMV6-TRF2 delB, pCMV6-TRF2 delM, and pCMV6-TRF2 delBdelM expression vectors, which were used to investigate the role of different TRF2 domains in regulating PCGF3 promoter activity in this study.
Snippet: The promoter region of PCGF3 harboring TRF2 binding peak was cloned into pGL3 vector between KpnI and HindIII restriction sites. The pCMV6-TRF2, pCMV6-TRF2 delB, pCMV6-TRF2 delM, and pCMV6-TRF2 delBdelM vectors were procured from Origene
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products