OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MACROD2 (NM_080676) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC222689
MACROD2 (Myc-DDK-tagged)-Human MACRO domain containing 2 (MACROD2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "MACROD2 or NM_080676"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MACROD2
Synonyms C2orf133; C20orf133
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC222689 representing NM_080676
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACCCCAGCAACAAGAAGAAAAAGGTGTGGAGAGAGGAGAAAGAACGTTTATTGAAGATGACCTTAG
AAGAGAGACGCAAAGAATACCTAAGAGACTATATTCCCCTGAACAGCATTCTGTCATGGAAGGAGGAGAT
GAAGGGCAAGGGCCAAAATGATGAAGAAAATACTCAGGAAACATCCCAGGTGAAGAAAAGTTTGACTGAA
AAAGTTTCTCTCTATAGAGGTGACATCACATTGCTAGAGGTAGATGCTATAGTCAATGCCGCAAATGCCA
GTCTTCTTGGAGGAGGAGGTGTGGATGGCTGTATTCATAGAGCAGCCGGCCCCTGTTTGCTAGCTGAATG
TCGTAACCTGAATGGCTGTGATACTGGACATGCAAAAATCACATGTGGCTATGACCTTCCTGCAAAATAT
GTCATCCATACTGTAGGGCCAATAGCCAGGGGCCATATTAATGGTTCCCACAAGGAAGACCTTGCAAATT
GCTATAAATCATCTCTGAAGCTCGTGAAAGAAAATAACATCCGATCAGTTGCATTTCCCTGCATCTCAAC
AGGCATTTATGGCTTTCCCAACGAGCCTGCTGCAGTCATTGCCCTCAACACCATTAAGGAATGGCTTGCC
AAGAATCACCATGAGGTGGATCGGATCATTTTCTGTGTCTTCTTAGAAGTTGACTTCAAAATCTACAAAA
AGAAAATGAATGAGTTTTTCTCCGTAGACGATAATAATGAAGAAGAAGAGGATGTTGAAATGAAAGAAGA
TTCAGATGAGAACGGTCCAGAGGAGAAGCAAAGTGTGGAAGAAATGGAAGAGCAGAGCCAAGATGCAGAT
GGTGTCAACACTGTCACTGTGCCCGGCCCTGCTTCAGAAGAGGCAGTTGAAGACTGTAAAGATGAAGATT
TTGCAAAGGATGAAAATATTACAAAAGGCGGTGAAGTGACAGATCATTCTGTGCGTGACCAAGATCATCC
CGATGGACAAGAGAATGATTCAACGAAGAATGAAATAAAAATTGAAACAGAATCGCAGAGCTCATATATG
GAAACAGAAGAACTTTCATCAAACCAAGAAGATGCCGTGATTGTGGAGCAACCAGAAGTGATTCCATTAA
CAGAGGACCAAGAAGAAAAAGAAGGTGAAAAAGCTCCAGGCGAGGACACACCTAGGATGCCTGGGAAAAG
TGAAGGCTCCAGTGACCTAGAAAATACTCCAGGTCCTGATGCAGGGGCACAAGATGAAGCGAAGGAACAA
AGAAATGGAACTAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC222689 representing NM_080676
Red=Cloning site Green=Tags(s)

MYPSNKKKKVWREEKERLLKMTLEERRKEYLRDYIPLNSILSWKEEMKGKGQNDEENTQETSQVKKSLTE
KVSLYRGDITLLEVDAIVNAANASLLGGGGVDGCIHRAAGPCLLAECRNLNGCDTGHAKITCGYDLPAKY
VIHTVGPIARGHINGSHKEDLANCYKSSLKLVKENNIRSVAFPCISTGIYGFPNEPAAVIALNTIKEWLA
KNHHEVDRIIFCVFLEVDFKIYKKKMNEFFSVDDNNEEEEDVEMKEDSDENGPEEKQSVEEMEEQSQDAD
GVNTVTVPGPASEEAVEDCKDEDFAKDENITKGGEVTDHSVRDQDHPDGQENDSTKNEIKIETESQSSYM
ETEELSSNQEDAVIVEQPEVIPLTEDQEEKEGEKAPGEDTPRMPGKSEGSSDLENTPGPDAGAQDEAKEQ
RNGTK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_080676
ORF Size 1275 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_080676.5, NP_542407.2
RefSeq Size 4863 bp
RefSeq ORF 1278 bp
Locus ID 140733
UniProt ID A1Z1Q3
Cytogenetics 20p12.1
MW 47.2 kDa
Summary The protein encoded by this gene is a deacetylase involved in removing ADP-ribose from mono-ADP-ribosylated proteins. The encoded protein has been shown to translocate from the nucleus to the cytoplasm upon DNA damage. provided by RefSeq, May 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_080676" in other vectors (6)
SKU Description Size Price
RC222689L1 Lenti ORF clone of Human MACRO domain containing 2 (MACROD2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC222689L2 Lenti ORF clone of Human MACRO domain containing 2 (MACROD2), transcript variant 1, mGFP tagged 10 ug
$757.00
RC222689L3 Lenti ORF clone of Human MACRO domain containing 2 (MACROD2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC222689L4 Lenti ORF clone of Human MACRO domain containing 2 (MACROD2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG222689 MACROD2 (tGFP-tagged) - Human MACRO domain containing 2 (MACROD2), transcript variant 1 10 ug
$489.00 $657.00
SC302699 MACROD2 (untagged)-Human MACRO domain containing 2 (MACROD2), transcript variant 1 10 ug
$457.00

Plasmid Map for RC222689

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC222689
Circular map for RC222689

file-alt Citations

The ARH and Macrodomain Families of α-ADP-ribose-acceptor Hydrolases Catalyze α-NAD+ Hydrolysis
Stevens, Kato, Kasamatsu et al
ACS Chem. Biol. (2019)
AI Summary: OriGene Technologies provided human MacroD1, MacroD2, C6orf130, and PARG cDNA vectors, which were essential for expressing and studying the enzymatic activities of these proteins in the research.
Snippet: Human acroD1" style="font-weight: bold;">MacroD1, acroD2" style="font-weight: bold;">MacroD2, C6orf130, and PARG cDNA vectors were obtained from Origene Technologies. PARG catalytic domain (PARGCD)(58) was amplified from PARG cDNA vector with forward 5′-ac gcgatcgcATGAATGATTTAAATGCTAAACTACCTGGA-3′ and reverse 5′-ac acgcgtTCAGGTCCCTGTCCTTTGCCCTGAATGGTC-3′ primers
Loss of the Mono-ADP-Ribosyltransferase, TIPARP, Increases Sensitivity to Dioxin-Induced Steatohepatitis and Lethality
Ahmed, Bott, Gomez et al
J. Biol. Chem. (2015)
AI Summary: OriGene's pCMV6 Myc-DDK MacroD1 and pCMV6 Myc-DDK MacroD2 variant 1 plasmids were used as templates to amplify human MacroD1 and MacroD2 cDNAs, facilitating the study of their roles in dioxin-induced toxicity and TIPARP-mediated regulation.
Snippet: Human acroD1" style="font-weight: bold;">MacroD1 and acroD2" style="font-weight: bold;">MacroD2 cDNAs were amplified by PCR using pCMV6 Myc-DDK acroD1" style="font-weight: bold;">MacroD1 or pCMV6 Myc-DDK acroD2" style="font-weight: bold;">MacroD2 variant 1 as templates, respectively (Origene, Rockville, MD). The PCR primers for acroD1" style="font-weight: bold;">MacroD1 were forward primer 5`- ... Cite SaveSaving
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products