OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPBAR1 (NM_170699) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC221897
GPBAR1 (Myc-DDK-tagged)-Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA336959 Rabbit Polyclonal TGR5/GPBAR1 Antibody
100 ul
$730.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GPBAR1 or NM_170699"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GPBAR1
Synonyms BG37; GPCR19; GPR131; M-BAR; TGR5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221897 representing NM_170699
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACGCCCAACAGCACTGGCGAGGTGCCCAGCCCCATTCCCAAGGGGGCTTTGGGGCTCTCCCTGGCCC
TGGCAAGCCTCATCATCACCGCGAACCTGCTCCTAGCCCTGGGCATCGCCTGGGACCGCCGCCTGCGCAG
CCCACCTGCTGGCTGCTTCTTCCTGAGCCTACTGCTGGCTGGGCTGCTCACGGGTCTGGCATTGCCCACA
TTGCCAGGGCTGTGGAACCAGAGTCGCCGGGGTTACTGGTCCTGCCTCCTCGTCTACTTGGCTCCCAACT
TCTCCTTCCTCTCCCTGCTTGCCAACCTCTTGCTGGTGCACGGGGAGCGCTACATGGCAGTCCTGAGGCC
ACTCCAGCCCCCTGGGAGCATTCGGCTGGCCCTGCTCCTCACCTGGGCTGGTCCCCTGCTCTTTGCCAGT
CTGCCCGCTCTGGGGTGGAACCACTGGACCCCTGGTGCCAACTGCAGCTCCCAGGCTATCTTCCCAGCCC
CCTACCTGTACCTCGAAGTCTATGGGCTCCTGCTGCCCGCCGTGGGTGCTGCTGCCTTCCTCTCTGTCCG
CGTGCTGGCCACTGCCCACCGCCAGCTGCAGGACATCTGCCGGCTGGAGCGGGCAGTGTGCCGCGATGAG
CCCTCCGCCCTGGCCCGGGCCCTTACCTGGAGGCAGGCAAGGGCACAGGCTGGAGCCATGCTGCTCTTCG
GGCTGTGCTGGGGGCCCTACGTGGCCACACTGCTCCTCTCAGTCCTGGCCTATGAGCAGCGCCCGCCACT
GGGGCCTGGGACACTGTTGTCCCTCCTCTCCCTAGGAAGTGCCAGTGCAGCGGCAGTGCCCGTAGCCATG
GGGCTGGGCGATCAGCGCTACACAGCCCCCTGGAGGGCAGCCGCCCAAAGGTGCCTGCAGGGGCTGTGGG
GAAGAGCCTCCCGGGACAGTCCCGGCCCCAGCATTGCCTACCACCCAAGCAGCCAAAGCAGTGTCGACCT
GGACTTGAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221897 representing NM_170699
Red=Cloning site Green=Tags(s)

MTPNSTGEVPSPIPKGALGLSLALASLIITANLLLALGIAWDRRLRSPPAGCFFLSLLLAGLLTGLALPT
LPGLWNQSRRGYWSCLLVYLAPNFSFLSLLANLLLVHGERYMAVLRPLQPPGSIRLALLLTWAGPLLFAS
LPALGWNHWTPGANCSSQAIFPAPYLYLEVYGLLLPAVGAAAFLSVRVLATAHRQLQDICRLERAVCRDE
PSALARALTWRQARAQAGAMLLFGLCWGPYVATLLLSVLAYEQRPPLGPGTLLSLLSLGSASAAAVPVAM
GLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_170699
ORF Size 990 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_170699.3
RefSeq Size 1400 bp
RefSeq ORF 993 bp
Locus ID 151306
UniProt ID Q8TDU6
Cytogenetics 2q35
Protein Families Druggable Genome
MW 35.1 kDa
Summary This gene encodes a member of the G protein-coupled receptor (GPCR) superfamily. This enzyme functions as a cell surface receptor for bile acids. Treatment of cells expressing this GPCR with bile acids induces the production of intracellular cAMP, activation of a MAP kinase signaling pathway, and internalization of the receptor. The receptor is implicated in the suppression of macrophage functions and regulation of energy homeostasis by bile acids. Alternative splicing results in multiple transcript variants encoding the same protein. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_170699" in other vectors (6)
SKU Description Size Price
RC221897L1 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC221897L2 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3, mGFP tagged 10 ug
$600.00
RC221897L3 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3, Myc-DDK-tagged 10 ug
$600.00
RC221897L4 Lenti ORF clone of Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3, mGFP tagged 10 ug
$600.00
RG221897 GPBAR1 (tGFP-tagged) - Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3 10 ug
$489.00 $500.00
SC123312 GPBAR1 (untagged)-Human G protein-coupled bile acid receptor 1 (GPBAR1), transcript variant 3 10 ug
$300.00

Plasmid Map for RC221897

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC221897
Circular map for RC221897

file-alt Citations

Discovery and characterization of small-molecule TGR5 ligands with agonistic activity
Papadopoulos, Perhal, Medel-Lacruz et al
European Journal of Medicinal Chemistry (2024)
Cited by 8
AI Summary: OriGene’s GPBAR1 transcript variant 3 (NM_170699) Human Untagged cDNA Clone (SC123312) was used as the source of TGR5 cDNA for expression studies in this research.
Snippet: GPBAR1 transcript variant 3 (NM_170699) Human Untagged cDNA Clone (SC123312) was obtained from OriGene Technologies GmbH (Herford, Germany) and subcloned into the pcDNA3.1/Zeo(+) mammalian expression vector (Thermo Fisher Scientific) using the restriction sites NotI/NotI (New England
In Silico Workflow for the Discovery of Natural Products Activating the G Protein-Coupled Bile Acid Receptor 1
Kirchweger, Kratz, Ladurner et al
Front Chem (2018) 6, 242 DOI: 10.3389/fchem.2018.00242
Cited by 25
AI Summary: In this study, OriGene's human GPBAR1 expression clone (Cat# RC221577) and Dual-Luciferase® Reporter Assay System (Cat# PR-E1910) were used to experimentally validate the activation of GPBAR1 by virtual hit compounds identified through in silico screening.
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products