OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MFF (NM_020194) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC221492
MFF (Myc-DDK-tagged)-Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA367132 MFF rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "MFF or NM_020194"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol MFF
Synonyms C2orf33; EMPF2; GL004
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221492 representing NM_020194
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTAAAGGAACAAGCAGTGACACATCACTAGGAAGGGTGAGCAGGGCAGCATTTCCTTCTCCCACTG
CTGCTGAGATGGCAGAAATTAGTCGAATTCAGTACGAAATGGAATATACTGAAGGCATTAGTCAGCGAAT
GAGGGTCCCAGAAAAGTTAAAAGTAGCACCGCCAAACGCTGACCTGGAACAAGGATTCCAAGAAGGAGTT
CCAAATGCTAGTGTGATAATGCAAGTTCCGGAGAGGATTGTTGTAGCAGGAAATAATGAAGATGTTTCAT
TTTCAAGACCAGCAGATCTTGACCTTATTCAGTCAACTCCCTTTAAACCCCTGGCACTGAAAACACCACC
TCGTGTACTTACGCTGAGTGAAAGACCACTAGATTTTCTGGATTTAGAAAGACCTCCTACAACCCCTCAA
AATGAAGAAATCCGAGCAGTTGGCAGACTAAAAAGAGAGCGGTCTATGAGTGAAAATGCTGTTCGCCAAA
ATGGACAGCTGGTCAGAAATGATTCTCTGTGGCACAGATCAGATTCTGCCCCAAGAAATAAAATTTCAAG
GTTCCAGGCACCGATTTCTGCACCGGAGTACACTGTGACACCATCGCCACAACAGGCTCGGGTCTGTCCT
CCCCATATGTTACCTGAAGATGGAGCTAATCTTTCCTCTGCTCGTGGCATTTTGTCGCTTATCCAGTCTT
CTACTCGTAGGGCATACCAGCAGATCTTGGATGTGCTGGATGAAAATCGCAGACCTGTGTTGCGTGGTGG
GTCTGCTGCCGCCACTTCTAATCCTCATCATGACAACGTCAGGTATGGCATTTCAAATATAGATACAACC
ATTGAAGGAACGTCAGATGACCTGACTGTTGTAGATGCAGCTTCACTAAGACGACAGATAATCAAACTAA
ATAGACGTCTACAACTTCTGGAAGAGGAGAACAAAGAACGTGCTAAAAGAGAAATGGTCATGTATTCAAT
TACTGTAGCTTTCTGGCTGCTTAATAGCTGGCTCTGGTTTCGCCGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221492 representing NM_020194
Red=Cloning site Green=Tags(s)

MSKGTSSDTSLGRVSRAAFPSPTAAEMAEISRIQYEMEYTEGISQRMRVPEKLKVAPPNADLEQGFQEGV
PNASVIMQVPERIVVAGNNEDVSFSRPADLDLIQSTPFKPLALKTPPRVLTLSERPLDFLDLERPPTTPQ
NEEIRAVGRLKRERSMSENAVRQNGQLVRNDSLWHRSDSAPRNKISRFQAPISAPEYTVTPSPQQARVCP
PHMLPEDGANLSSARGILSLIQSSTRRAYQQILDVLDENRRPVLRGGSAAATSNPHHDNVRYGISNIDTT
IEGTSDDLTVVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLWFRR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_020194
ORF Size 1026 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020194.5, NP_064579.3
RefSeq Size 2032 bp
RefSeq ORF 1029 bp
Locus ID 56947
UniProt ID Q9GZY8, A1MAC2
Cytogenetics 2q36.3
Protein Families Transmembrane
MW 38.3 kDa
Summary This is a nuclear gene encoding a protein that functions in mitochondrial and peroxisomal fission. The encoded protein recruits dynamin-1-like protein (DNM1L) to mitochondria. There are multiple pseudogenes for this gene on chromosomes 1, 5, and X. Alternative splicing results in multiple transcript variants. provided by RefSeq, Mar 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_020194" in other vectors (7)
SKU Description Size Price
RC221492L1 Lenti ORF clone of Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$757.00
RC221492L2 Lenti ORF clone of Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$757.00
RC221492L3 Lenti ORF clone of Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$757.00
RC221492L4 Lenti ORF clone of Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$757.00
RG221492 MFF (tGFP-tagged) - Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein 10 ug
$489.00 $657.00
SC113168 MFF (untagged)-Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein 10 ug
$503.00
SC317528 MFF (untagged)-Human mitochondrial fission factor (MFF), nuclear gene encoding mitochondrial protein 10 ug
$503.00

Plasmid Map for RC221492

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC221492
Circular map for RC221492

file-alt Citations

CerS6-Derived Sphingolipids Interact with Mff and Promote Mitochondrial Fragmentation in Obesity
Hammerschmidt, Ostkotte, Nolte et al
Cell (2019) 177 (6), 1536-1552.e23 DOI: 10.1016/j.cell.2019.05.008
AI Summary: OriGene products pCMV6-MycDDK-hMFF and pCMV6-MycDDK-hCD99 plasmids were used in this study to express human MFF and CD99 proteins, enabling the investigation of their roles and interactions in CerS6-derived sphingolipid-mediated mitochondrial fragmentation in obesity.
Snippet: Plasmid: pCMV6-MycDDK-hMFF OriGene Cat# RC221492 RefSeq# NM_020194 Plasmid: pCMV6-MycDDK-hCD99 OriGene Cat# RC204056 RefSeq# NM_002414
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products