OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PPP2R2D (NM_001003656) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC221048
PPP2R2D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA335514 Rabbit Polyclonal Anti-Ppp2r2d Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PPP2R2D or NM_001003656"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PPP2R2D
Synonyms MDS026
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC221048 representing NM_001003656
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGAGCTGACCGAAGTCATCACTGCAGCCGAGTTCCACCCGCACCAGTGCAACGTGTTCGTCTACA
GCAGTAGCAAAGGGACCATCCGCCTGTGTGACATGCGCTCCTCGGCCCTGTGCGACAGACACTCCAAGTT
TTTTGAAGAGCCTGAAGATCCCAGCAGTAGGTCCTTCTTCTCAGAAATAATTTCATCCATATCCGATGTA
AAATTCAGTCATAGTGGGCGGTACATGATGACCAGAGACTACCTGTCGGTGAAGGTGTGGGACCTCAACA
TGGAGAGCAGGCCGGTGGAGACCCACCAGGTCCACGAGTACCTGCGCAGCAAGCTCTGCTCTCTCTATGA
GAACGACTGCATCTTTGACAAGTTTGAGTGTTGCTGGAACGGTTCGGATAGCGCCATCATGACCGGGTCC
TATAACAACTTCTTCAGGATGTTTGATAGAGACACGCGGAGGGATGTGACCCTGGAGGCCTCGAGAGAGA
GCAGCAAACCGCGCGCCAGCCTCAAACCCCGGAAGGTGTGTACGGGGGGTAAGCGGAGGAAAGACGAGAT
CAGTGTGGACAGTCTGGACTTCAACAAGAAGATCCTGCACACAGCCTGGCACCCCGTGGACAATGTCATT
GCCGTGGCTGCCACCAATAACTTGTACATATTCCAGGACAAAATCAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC221048 representing NM_001003656
Red=Cloning site Green=Tags(s)

MEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCDRHSKFFEEPEDPSSRSFFSEIISSISDV
KFSHSGRYMMTRDYLSVKVWDLNMESRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSAIMTGS
YNNFFRMFDRDTRRDVTLEASRESSKPRASLKPRKVCTGGKRRKDEISVDSLDFNKKILHTAWHPVDNVI
AVAATNNLYIFQDKIN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001003656
ORF Size 678 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001003656.1, NP_001003656.1
RefSeq Size 2091 bp
RefSeq ORF 680 bp
Locus ID 55844
Cytogenetics 10q26.3
Protein Families Druggable Genome, Phosphatase
Protein Pathways Tight junction
MW 26.1 kDa
Summary B regulatory subunit of protein phosphatase 2A (PP2A) that plays a key role in cell cycle by controlling mitosis entry and exit. The activity of PP2A complexes containing PPP2R2D (PR55-delta) fluctuate during the cell cycle: the activity is high in interphase and low in mitosis. During mitosis, activity of PP2A is inhibited via interaction with phosphorylated ENSA and ARPP19 inhibitors. Within the PP2A complexes, the B regulatory subunits modulate substrate selectivity and catalytic activity, and also may direct the localization of the catalytic enzyme to a particular subcellular compartment (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001003656" in other vectors (6)
SKU Description Size Price
RC221048L1 Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC221048L2 Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2, mGFP tagged 10 ug
$600.00
RC221048L3 Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC221048L4 Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2, mGFP tagged 10 ug
$600.00
RG221048 PPP2R2D (tGFP-tagged) - Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2 10 ug
$489.00 $500.00
SC113475 PPP2R2D (untagged)-Human protein phosphatase 2, regulatory subunit B, delta isoform (PPP2R2D), transcript variant 2 10 ug
$300.00

Plasmid Map for RC221048

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC221048
Circular map for RC221048

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products