OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NDFIP2 (NM_019080) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC220371
NDFIP2 (Myc-DDK-tagged)-Human Nedd4 family interacting protein 2 (NDFIP2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA331085 Rabbit polyclonal Anti-NDFIP2 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "NDFIP2 or NM_019080"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol NDFIP2
Synonyms N4WBP5A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC220371 representing NM_019080
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATT
CGTCGACTGGATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC

ATGGCACGCCGGCGGAGCCAGCGAGTCTGCGCGAGCGGTCCGAGCATGCTCAATAGCGCG
CGCGGCGCCCCGGAGCTTCTCCGCGGAACCGCGACCAACGCGGAGGTCTCGGCGGCCGCT
GCGGGAGCCACAGGAAGTGAAGAGCTTCCGCCGGGAGACCGCGGCTGCAGGAACGGAGGC
GGAAGGGGCCCTGCGGCGACGACGTCGTCGACGGGGGTGGCCGTGGGAGCTGAGCACGGA
GAAGACTCCCTCTCTCGGAAGCCGGATCCCGAGCCGGGCAGGATGGATCACCACCAGCCG
GGGACTGGGCGCTACCAGGTGCTTCTTAATGAAGAGGATAACTCAGAATCATCGGCTATA
GAGCAGCCACCTACTTCAAACCCAGCACCGCAGATTGTGCAGGCTGCGTCTTCAGCACCA
GCACTTGAAACTGACTCTTCCCCTCCACCATATAGTAGTATTACTGTGGAAGTACCTACA
ACTTCAGATACAGAAGTTTACGGTGAGTTTTATCCCGTGCCACCTCCCTATAGCGTTGCT
ACCTCTCTTCCTACATACGATGAAGCTGAGAAGGCTAAAGCTGCTGCAATGGCAGCTGCA
GCAGCAGAAACATCTCAAAGAATTCAGGAGGAAGAGTGTCCACCAAGAGATGACTTCAGT
GATGCAGACCAGCTCAGAGTGGGGAATGATGGCATTTTCATGCTGGCATTTTTCATGGCA
TTTATTTTCAACTGGCTTGGATTTTGTTTATCCTTCTGTATCACCAATACCATAGCTGGA
AGGTATGGTGCTATCTGCGGATTTGGCCTTTCCTTGATCAAATGGATCCTTATTGTCAGG
TTTTCTGATTATTTTACTGGATATTTCAATGGACAGTATTGGCTTTGGTGGATATTTCTT
GTACTTGGCCTGCTCCTTTTCTTCAGAGGATTTGTTAATTATCTAAAAGTCAGAAACATG
TCTGAAAGTATGGCAGCTGCTCATAGAACAAGGTATTTCTTCTTATTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATTACAAGGAT
GACGACGATAAGGTTTAAA
Protein Sequence
>RC220371 protein sequence
Blue=ORF Red=Cloning site Green=Tag(s)

MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGG
GRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAI
EQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVA
TSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMA
FIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_019080
ORF Size 1008 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_019080.3
RefSeq Size 2636 bp
RefSeq ORF 1011 bp
Locus ID 54602
UniProt ID Q9NV92
Cytogenetics 13q31.1
Protein Families Transmembrane
MW 36.2 kDa
Summary Activates HECT domain-containing E3 ubiquitin-protein ligases, including ITCH, NEDD4, NEDD4L, SMURF2, WWP1 and WWP2, and consequently modulates the stability of their targets. As a result, may control many cellular processes. Recruits ITCH, NEDD4 and SMURF2 to endosomal membranes. Negatively regulates KCNH2 potassium channel activity by decreasing its cell-surface expression and interfering with channel maturation through recruitment of NEDD4L to the Golgi apparatus and multivesicular body where it mediates KCNH2 degradation (PubMed:26363003). May modulate EGFR signaling. Together with NDFIP1, limits the cytokine signaling and expansion of effector Th2 T-cells by promoting degradation of JAK1, probably by ITCH- and NEDD4L-mediated ubiquitination (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_019080" in other vectors (4)
SKU Description Size Price
RC220371L3 Lenti ORF clone of Human Nedd4 family interacting protein 2 (NDFIP2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC220371L4 Lenti ORF clone of Human Nedd4 family interacting protein 2 (NDFIP2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG220371 NDFIP2 (tGFP-tagged) - Human Nedd4 family interacting protein 2 (NDFIP2), transcript variant 1 10 ug
$657.00
SC304668 NDFIP2 (untagged)-Human Nedd4 family interacting protein 2 (NDFIP2), transcript variant 1 10 ug
$457.00

Plasmid Map for RC220371

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC220371
Circular map for RC220371

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products