OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

STAM1 (STAM) (NM_003473) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC219230
STAM (Myc-DDK-tagged)-Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $503.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349561 Rabbit Polyclonal Anti-STAM Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "STAM1 or NM_003473"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol STAM1
Synonyms STAM-1; STAM1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC219230 representing NM_003473
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTTTTTGCCACCAATCCCTTCGATCAGGATGTTGAGAAAGCAACCAGCGAGATGAATACTGCTG
AGGACTGGGGCCTCATTTTGGATATCTGTGATAAAGTTGGTCAGTCTCGCACTGGACCTAAGGATTGTCT
TCGGTCTATTATGAGAAGAGTGAACCACAAAGATCCTCACGTTGCTATGCAGGCTTTGACTCTTCTAGGA
GCATGTGTATCAAACTGTGGCAAAATTTTTCATTTAGAAGTATGTTCAAGAGATTTTGCTAGTGAAGTAA
GCAACGTATTAAATAAGGGTCATCCTAAAGTATGTGAAAAATTAAAGGCTCTTATGGTTGAATGGACAGA
TGAATTTAAGAATGATCCACAGCTTAGTCTAATATCAGCAATGATTAAGAACCTTAAGGAACAAGGAGTT
ACGTTCCCAGCTATTGGCTCTCAGGCTGCAGAACAAGCAAAAGCAAGCCCAGCTCTTGTAGCCAAGGATC
CTGGTACTGTGGCTAACAAAAAAGAAGAAGAAGATTTAGCAAAAGCCATTGAGTTGTCTCTCAAGGAACA
AAGGCAGCAGTCAACCACCCTTTCCACTTTGTATCCAAGCACATCCAGTCTCTTAACTAACCACCAACAT
GAAGGCCGAAAAGTTCGTGCTATATATGACTTTGAAGCTGCTGAAGACAATGAACTTACTTTTAAAGCTG
GAGAAATTATTACAGTTCTTGATGACAGTGATCCTAACTGGTGGAAAGGTGAAACCCATCAAGGCATAGG
GTTATTTCCTTCTAATTTTGTGACTGCAGATCTCACTGCTGAACCAGAAATGATTAAAACAGAGAAGAAG
ACGGTACAATTTAGTGATGATGTTCAGGTAGAGACAATAGAACCAGAGCCGGAACCAGCCTTTATTGATG
AAGATAAAATGGACCAGTTGCTACAGATGCTGCAAAGTACAGACCCCAGTGATGATCAGCCAGACCTACC
AGAGCTGCTTCATCTTGAAGCAATGTGTCACCAGATGGGACCTCTCATTGATGAAAAGCTGGAAGATATT
GATAGAAAACATTCAGAACTCTCAGAACTTAATGTGAAAGTGATGGAGGCCCTTTCCTTATATACCAAGT
TAATGAACGAAGATCCGATGTATTCCATGTATGCAAAGTTACAGAATCAGCCATATTATATGCAGTCATC
TGGTGTTTCTGGTTCTCAGGTGTATGCAGGGCCTCCTCCAAGTGGTGCCTACCTGGTTGCAGGGAACGCG
CAGATGAGCCACCTCCAGAGCTACAGTCTTCCCCCGGAGCAGCTGTCTTCTCTCAGCCAGGCAGTGGTCC
CACCATCCGCAAACCCAGCCCTTCCTAGTCAGCAGACTCAGGCCGCTTACCCAAATACAATGGTCAGTTC
CGTTCAAGGAAACACATATCCCAGCCAGGCGCCAGTATATAGTCCTCCTCCTGCCGCTACTGCTGCTGCT
GCAACTGCCGATGTCACTCTGTACCAGAATGCAGGACCTAATATGCCCCAGGTGCCAAACTATAACTTAA
CATCATCAACTCTGCCTCAGCCCGGAGGCAGCCAACAGCCACCTCAGCCACAGCAACCATATTCTCAGAA
GGCTCTGCTA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC219230 representing NM_003473
Red=Cloning site Green=Tags(s)

MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG
ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV
TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH
EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK
TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA
ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003473
ORF Size 1620 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003473.4
RefSeq Size 2967 bp
RefSeq ORF 1623 bp
Locus ID 8027
UniProt ID Q92783
Cytogenetics 10p12.33
Domains SH3, UIM, VHS
Protein Pathways Endocytosis, Jak-STAT signaling pathway
MW 59 kDa
Summary This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. provided by RefSeq, Feb 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003473" in other vectors (6)
SKU Description Size Price
RC219230L1 Lenti ORF clone of Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1, Myc-DDK-tagged 10 ug
$803.00
RC219230L2 Lenti ORF clone of Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1, mGFP tagged 10 ug
$803.00
RC219230L3 Lenti ORF clone of Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1, Myc-DDK-tagged 10 ug
$803.00
RC219230L4 Lenti ORF clone of Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1, mGFP tagged 10 ug
$803.00
RG219230 STAM (tGFP-tagged) - Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1 10 ug
$489.00 $703.00
SC117957 STAM (untagged)-Human signal transducing adaptor molecule (SH3 domain and ITAM motif) 1 (STAM), transcript variant 1 10 ug
$504.00

Plasmid Map for RC219230

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC219230
Circular map for RC219230

file-alt Citations

Proteomic analyses of signalling complexes associated with receptor tyrosine kinase identify novel members of fibroblast growth factor receptor 3 interactome
Balek, Nemec, Konik et al
Cell. Signal. (2017)
AI Summary: In this study, OriGene products—specifically vectors expressing STAM1, SHOX2, and EEF1A1—were used to facilitate the identification and validation of novel protein interactions within the FGFR3 signalling complex.
Snippet: …Vectors expressing STAM1, SHOX2 and EEF1A1 were obtained from Origene (San Diego, CA). …Vectors expressing STAM1, SHOX2 and EEF1A1 were obtained from Origene (San Diego, CA). …
The Dual Role of an ESCRT-0 Component HGS in HBV Transcription and Naked Capsid Secretion
Chou, Tsai, Huang
PLOS pathogens (2015) 11 (10)
AI Summary: OriGene contributed Myc-Flag-tagged HGS, STAM1, and STAM2 expression vectors to the study, enabling the investigation of these ESCRT-0 components in HBV transcription and naked capsid secretion.
Snippet: …The Myc-Flag-tagged HGS, STAM1, and STAM2 expression vectors used in the study were all purchased from OriGene. Plasmid HGS dUIM was derived from the wild type HGS backbone by deleting a putative ubiquitin-interaction motif at amino acid 257–277 by PCR amplification. …
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products