OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GRIM19 (NDUFA13) (NM_015965) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC218988
NDUFA13 (Myc-DDK-tagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA350036 Rabbit Polyclonal Anti-NDUFA13 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GRIM19 or NM_015965"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GRIM19
Synonyms B16.6; CDA016; CGI-39; GRIM-19; GRIM19; MC1DN28
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218988 representing NM_015965
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAAGAACCAAGGCGAGTCACGCCCTGTCTGGGCAAAAGAGGAGTAAAGACCCCTCAGCTGCAGCCCG
GCAGCGCATTCCTACCCAGGGTCCGCCGCCAGAGCTTTCCCGCGCGGTCGGATAGTTACACTACTGTCCG
GGACTTCCTAGCCGTGCCGCGGACCATCTCAAGTGCTTCCGCCACACTCATCATGGCGGTGGCAGTAAGT
CACTTCCGCCCGGGACCGGAAGTGTGGGATACTGCGAGTATGGCGGCGTCAAAGGTGAAGCAGGACATGC
CTCCGCCGGGGGGCTATGGGCCCATCGACTACAAACGGAACTTGCCGCGTCGAGGACTGTCGGGCTACAG
CATGCTGGCCATAGGGATTGGAACCCTGATCTACGGGCACTGGAGCATAATGAAGTGGAACCGTGAGCGC
AGGCGCCTACAAATCGAGGACTTCGAGGCTCGCATCGCGCTGTTGCCACTGTTACAGGCAGAAACCGACC
GGAGGACCTTGCAGATGCTTCGGGAGAACCTGGAGGAGGAGGCCATCATCATGAAGGACGTGCCCGACTG
GAAGGTGGGGGAGTCTGTGTTCCACACAACCCGCTGGGTGCCCCCCTTGATCGGGGAGCTGTACGGGCTG
CGCACCACAGAGGAGGCTCTCCATGCCAGCCACGGCTTCATGTGGTACACG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218988 protein sequence
Red=Cloning site Green=Tags(s)

MQEPRRVTPCLGKRGVKTPQLQPGSAFLPRVRRQSFPARSDSYTTVRDFLAVPRTISSASATLIMAVAVS
HFRPGPEVWDTASMAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRER
RRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGL
RTTEEALHASHGFMWYT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_015965
ORF Size 681 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_015965.5
RefSeq Size 1023 bp
RefSeq ORF 435 bp
Locus ID 51079
UniProt ID Q9P0J0
Cytogenetics 19p13.11
Protein Families Transcription Factors, Transmembrane
MW 25.82 kDa
Summary This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. provided by RefSeq, Oct 2009
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_015965" in other vectors (6)
SKU Description Size Price
RC218988L1 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC218988L2 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RC218988L3 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein, Myc-DDK-tagged 10 ug
$600.00
RC218988L4 Lenti ORF clone of Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein, mGFP tagged 10 ug
$600.00
RG218988 NDUFA13 (tGFP-tagged) - Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein 10 ug
$489.00 $500.00
SC127135 NDUFA13 (untagged)-Human NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 (NDUFA13), nuclear gene encoding mitochondrial protein 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products