OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAV3 (NM_001079874) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC218352
VAV3 (Myc-DDK-tagged)-Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA367362 VAV3 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "VAV3 or NM_001079874"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol VAV3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC218352 representing NM_001079874
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAATTTTTACATTTCTTTCAGAACAAGGGACACTCAAACTACCAGAGAAACGGACCAATGGACTGC
GAAGAACTCCTAAACAGGTGGATCCAGGTTTACCAAAGATGCAGGTCATTAGGAACTATTCTGGAACACC
ACCCCCAGCTCTGCATGAAGGACCCCCTTTACAGCTCCAGGCCGGGGATACCGTTGAACTTCTGAAAGGA
GATGCACACAGTCTGTTTTGGCAGGGCAGAAATTTAGCATCTGGAGAGGTTGGATTTTTTCCAAGTGATG
CAGTCAAGCCTTGCCCATGTGTGCCCAAACCAGTAGATTATTCTTGCCAACCCTGGTATGCTGGAGCAAT
GGAAAGATTGCAAGCAGAGACCGAACTTATTAATAGGGTAAATAGTACTTACCTTGTGAGGCACAGGACC
AAAGAGTCAGGAGAATATGCAATTAGCATTAAGTACAATAATGAAGCAAAGCACATCAAGATTTTAACAA
GAGATGGCTTTTTTCACATTGCAGAAAATAGAAAATTTAAAAGTTTAATGGAACTTGTGGAGTACTACAA
GCATCATTCTCTCAAGGAAGGGTTCAGAACCTTAGATACAACTCTGCAGTTTCCATACAAGGAGCCAGAA
CATTCAGCTGGACAGAGGGGTAATAGAGCAGGCAACAGCTTGTTAAGTCCAAAAGTGCTGGGCATTGCCA
TCGCTCGGTATGACTTCTGTGCAAGAGATATGAGAGAGTTGTCCTTGTTGAAAGGAGATGTGGTGAAGAT
TTACACAAAGATGAGTGCAAATGGCTGGTGGAGAGGAGAAGTAAATGGCAGGGTGGGCTGGTTTCCATCC
ACATATGTGGAAGAGGATGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC218352 representing NM_001079874
Red=Cloning site Green=Tags(s)

MPIFTFLSEQGTLKLPEKRTNGLRRTPKQVDPGLPKMQVIRNYSGTPPPALHEGPPLQLQAGDTVELLKG
DAHSLFWQGRNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERLQAETELINRVNSTYLVRHRT
KESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPE
HSAGQRGNRAGNSLLSPKVLGIAIARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPS
TYVEEDE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001079874
ORF Size 861 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001079874.2
RefSeq Size 3115 bp
RefSeq ORF 864 bp
Locus ID 10451
UniProt ID Q9UKW4
Cytogenetics 1p13.3
Protein Families Druggable Genome
Protein Pathways B cell receptor signaling pathway, Chemokine signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Leukocyte transendothelial migration, Natural killer cell mediated cytotoxicity, Regulation of actin cytoskeleton, T cell receptor signaling pathway
MW 32.4 kDa
Summary This gene is a member of the VAV gene family. The VAV proteins are guanine nucleotide exchange factors (GEFs) for Rho family GTPases that activate pathways leading to actin cytoskeletal rearrangements and transcriptional alterations. This gene product acts as a GEF preferentially for RhoG, RhoA, and to a lesser extent, RAC1, and it associates maximally with the nucleotide-free states of these GTPases. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001079874" in other vectors (6)
SKU Description Size Price
RC218352L1 Lenti ORF clone of Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC218352L2 Lenti ORF clone of Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2, mGFP tagged 10 ug
$600.00
RC218352L3 Lenti ORF clone of Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC218352L4 Lenti ORF clone of Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2, mGFP tagged 10 ug
$600.00
RG218352 VAV3 (tGFP-tagged) - Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2 10 ug
$489.00 $500.00
SC315719 VAV3 (untagged)-Human vav 3 guanine nucleotide exchange factor (VAV3), transcript variant 2 10 ug
$330.00

Plasmid Map for RC218352

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC218352
Circular map for RC218352

file-alt Citations

VAV3 Oncogene Expression in Colorectal Cancer: Clinical Aspects and Functional Characterization
Uen, Fang, Hseu et al
Sci Rep (2015) 5, 9360 DOI: 10.1038/srep09360
Cited by 44
AI Summary: OriGene’s Human VAV3 cDNA ORF and empty vectors were used to transfect FHC cells, enabling functional studies that demonstrated the role of VAV3 in colorectal cancer progression.
Snippet: of shRNA treatment. Transfection. FHC cells were transfected with Human VAV3 cDNA ORF and empty vectors (OriGene, Rockville, MD, USA) and stable clones resistant to G418 (St. Louis, MO, USA) were selected. RT-PCR ... Cite SaveSaving
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products