OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DAZAP1 (NM_170711) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC216522
DAZAP1 (Myc-DDK-tagged)-Human DAZ associated protein 1 (DAZAP1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA343885 Rabbit Polyclonal Anti-DAZAP1 Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DAZAP1 or NM_170711"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DAZAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC216522 representing NM_170711
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAACTCGGGCGCCGACGAGATCGGGAAGCTCTTCGTGGGCGGTCTTGACTGGAGCACGACCCAAG
AGACTCTGCGCAGCTACTTTTCCCAATATGGAGAAGTCGTAGATTGTGTTATCATGAAAGATAAAACCAC
CAACCAGTCTCGAGGCTTTGGGTTTGTCAAATTTAAAGACCCAAACTGTGTGGGGACGGTGCTGGCCAGC
AGACCGCACACGCTAGATGGCCGAAACATCGACCCCAAGCCATGCACACCCCGGGGGATGCAGCCGGAGA
GAACACGGCCGAAGGAAGGATGGCAGAAAGGACCCAGGAGCGATAACAGTAAATCAAATAAGATATTTGT
CGGTGGAATTCCTCACAATTGTGGTGAGACAGAGCTCAGGGAATACTTCAAGAAGTTCGGAGTGGTCACG
GAGGTAGTCATGATCTATGACGCCGAGAAGCAGAGGCCCCGAGGTTTTGGATTTATTACTTTCGAGGACG
AACAATCAGTGGACCAGGCTGTCAACATGCATTTTCACGACATCATGGGCAAAAAAGTGGAAGTTAAACG
AGCTGAGCCTCGGGACAGCAAGAGCCAAGCGCCGGGACAGCCAGGTGCCAGCCAGTGGGGGAGCCGGGTT
GTGCCCAACGCTGCCAATGGCTGGGCAGGCCAGCCCCCGCCCACGTGGCAGCAAGGATATGGCCCGCAAG
GAATGTGGGTGCCGGCAGGACAGGCGATTGGTGGCTATGGACCGCCCCCTGCAGGAAGAGGAGCCCCCCC
GCCACCCCCACCGTTCACCTCCTACATCGTGTCCACCCCTCCTGGAGGCTTTCCCCCTCCCCAGGGCTTC
CCTCAGGGCTACGGTGCCCCGCCACAGTTCAGTTTTGGCTACGGGCCTCCACCTCCACCGCCAGATCAGT
TTGCCCCTCCGGGGGTTCCTCCTCCACCAGCCACTCCCGGGGCAGCACCTCTGGCTTTCCCACCGCCTCC
GTCTCAGGCTGCCCCGGACATGAGCAAGCCCCCGACAGCTCAGCCAGACTTCCCCTATGGTCAGTATGGC
CTGGGTTCCTATTCTCCAGCCCCGCCGGGCTGCGGCCCACACTTTGTTTACAGTCTTATGGTCAGGCTGA
GCAGTGATGTGGCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC216522 representing NM_170711
Red=Cloning site Green=Tags(s)

MNNSGADEIGKLFVGGLDWSTTQETLRSYFSQYGEVVDCVIMKDKTTNQSRGFGFVKFKDPNCVGTVLAS
RPHTLDGRNIDPKPCTPRGMQPERTRPKEGWQKGPRSDNSKSNKIFVGGIPHNCGETELREYFKKFGVVT
EVVMIYDAEKQRPRGFGFITFEDEQSVDQAVNMHFHDIMGKKVEVKRAEPRDSKSQAPGQPGASQWGSRV
VPNAANGWAGQPPPTWQQGYGPQGMWVPAGQAIGGYGPPPAGRGAPPPPPPFTSYIVSTPPGGFPPPQGF
PQGYGAPPQFSFGYGPPPPPPDQFAPPGVPPPPATPGAAPLAFPPPPSQAAPDMSKPPTAQPDFPYGQYG
LGSYSPAPPGCGPHFVYSLMVRLSSDVA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_170711
ORF Size 1134 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_170711.3
RefSeq Size 2274 bp
RefSeq ORF 1137 bp
Locus ID 26528
UniProt ID Q96EP5
Cytogenetics 19p13.3
Protein Families Stem cell - Pluripotency
MW 40.3 kDa
Summary In mammals, the Y chromosome directs the development of the testes and plays an important role in spermatogenesis. A high percentage of infertile men have deletions that map to regions of the Y chromosome. The DAZ (deleted in azoospermia) gene cluster maps to the AZFc region of the Y chromosome and is deleted in many azoospermic and severely oligospermic men. It is thought that the DAZ gene cluster arose from the transposition, amplification, and pruning of the ancestral autosomal gene DAZL also involved in germ cell development and gametogenesis. This gene encodes a RNA-binding protein with two RNP motifs that was originally identified by its interaction with the infertility factors DAZ and DAZL. Two isoforms are encoded by transcript variants of this gene. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_170711" in other vectors (4)
SKU Description Size Price
RC216522L3 Lenti ORF clone of Human DAZ associated protein 1 (DAZAP1), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC216522L4 Lenti ORF clone of Human DAZ associated protein 1 (DAZAP1), transcript variant 1, mGFP tagged 10 ug
$757.00
RG216522 DAZAP1 (tGFP-tagged) - Human DAZ associated protein 1 (DAZAP1), transcript variant 1 10 ug
$657.00
SC313219 DAZAP1 (untagged)-Human DAZ associated protein 1 (DAZAP1), transcript variant 1 10 ug
$503.00

Plasmid Map for RC216522

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC216522
Circular map for RC216522

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products