OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KRTAP2-4 (NM_033184) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC215356
KRTAP2 (Myc-DDK-tagged)-Human keratin associated protein 2-4 (KRTAP2-4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KRTAP2-4 or NM_033184"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KRTAP2-4
Synonyms KAP2.1B; KAP2.3; KAP2.4; KRTAP2-3; KRTAP2.3; KRTAP2.4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC215356 representing NM_033184
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCGGCTCCTGCTGCGGCTCCACCTTGTCCTCCCTGAGCTACGGGGGAGGCTGCTGCCAGCCCTGCT
GCTGCCGCGACCCCTGCTGCTGCCGCCCCGTGACCTGCCAGACCACCGTGTGCCGCCCCGTGACCTGCGT
GCCCCGCTGCACGCGCCCCATCTGCGAGCCCTGCCGCCGCCCGGTGTGCTGCGACCCCTGCTCCCTGCAG
GAAGGCTGCTGCCGCCCCATCACCTGCTGCCCCTCGTCGTGCACGGCTGTGGTGTGCAGGCCCTGCTGCT
GGGCCACCACCTGCTGCCAGCCTGTGTCTGTGCAGTCCCCCTGCTGCCGGCCTCCCTGCGGCCAGCCGAC
CCCTTGCAGCACCACCTGCAGGACCTCCTCCTGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC215356 representing NM_033184
Red=Cloning site Green=Tags(s)

MTGSCCGSTLSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRRPVCCDPCSLQ
EGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCSTTCRTSSC

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_033184
ORF Size 384 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_033184.2, NP_149440.1
RefSeq Size 812 bp
RefSeq ORF 387 bp
Locus ID 85294
UniProt ID P0C7H8, Q9BYR9
Cytogenetics 17q21.2
MW 13.3 kDa
Summary This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- and carboxyl-terminal regions and are subdivided into three multi-gene families according to amino acid composition: the high sulfur, the ultrahigh sulfur, and the high tyrosine/glycine KAPs. This protein is a member of the high sulfur KAP family and the gene is localized to a cluster of KAPs at 17q12-q21. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_033184" in other vectors (6)
SKU Description Size Price
RC215356L1 Lenti ORF clone of Human keratin associated protein 2-4 (KRTAP2-4), Myc-DDK-tagged 10 ug
$450.00
RC215356L2 Lenti ORF clone of Human keratin associated protein 2-4 (KRTAP2-4), mGFP tagged 10 ug
$450.00
RC215356L3 Lenti ORF clone of Human keratin associated protein 2-4 (KRTAP2-4), Myc-DDK-tagged 10 ug
$450.00
RC215356L4 Lenti ORF clone of Human keratin associated protein 2-4 (KRTAP2-4), mGFP tagged 10 ug
$450.00
RG215356 KRTAP2 (tGFP-tagged) - Human keratin associated protein 2-4 (KRTAP2-4) 10 ug
$489.00
SC123080 KRTAP2 (untagged)-Human keratin associated protein 2-4 (KRTAP2-4) 10 ug
$150.00

Plasmid Map for RC215356

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC215356
Circular map for RC215356

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products