OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CLEC12A (NM_201623) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC213744
CLEC12A (Myc-DDK-tagged)-Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA372356 CLEC12A rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CLEC12A or NM_201623"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CLEC12A
Synonyms CD371; CLL-1; CLL1; DCAL-2; MICL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC213744 representing NM_201623.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGTCTGAAGAAGTTACTTATGCAGATCTTCAATTCCAGAACTCCAGTGAGATGGAAAAAATCCCAGAA
ATTGGCAAATTTGGGGAAAAAGTTCACGTAACTTTGAAGATAGAAATGAAAAAAATGAACAAACTACAA
AACATCAGTGAAGAGCTCCAGAGAAATATTTCTCTACAACTGATGAGTAACATGAATATCTCCAACAAG
ATCAGGAACCTCTCCACCACACTGCAAACAATAGCCACCAAATTATGTCGTGAGCTATATAGCAAAGAA
CAAGAGCACAAATGTAAGCCTTGTCCAAGGAGATGGATTTGGCATAAGGACAGCTGTTATTTCCTAAGT
GATGATGTCCAAACATGGCAGGAGAGTAAAATGGCCTGTGCTGCTCAGAATGCCAGCCTGTTGAAGATA
AACAACAAAAATGCATTGGAATTTATAAAATCCCAGAGTAGATCATATGACTATTGGCTGGGATTATCT
CCTGAAGAAGATTCCACTCGTGGTATGAGAGTGGATAATATAATCAACTCCTCTGCCTGGGTTATAAGA
AACGCACCTGACTTAAATAACATGTATTGTGGATATATAAATAGACTATATGTTCAATATTATCACTGC
ACTTATAAACAAAGAATGATATGTGAGAAGATGGCCAATCCAGTGCAGCTTGGTTCTACATATTTTAGG
GAGGCA
ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
Protein Sequence
>Peptide sequence encoded by RC213744
Blue=ORF Red=Cloning site Green=Tag(s)

MSEEVTYADLQFQNSSEMEKIPEIGKFGEKVHVTLKIEMKKMNKLQNISEELQRNISLQLMSNMNISNK
IRNLSTTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKI
NNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPDLNNMYCGYINRLYVQYYHC
TYKQRMICEKMANPVQLGSTYFREA
myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_201623
ORF Size 696 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_201623.1, NP_963917.1
RefSeq Size 1474 bp
RefSeq ORF 699 bp
Locus ID 160364
UniProt ID Q5QGZ9
Cytogenetics 12p13.31
Protein Families Druggable Genome, Transmembrane
MW 27.3 kDa
Summary This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signaling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. provided by RefSeq, May 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_201623" in other vectors (6)
SKU Description Size Price
RC213744L1 Lenti ORF clone of Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC213744L2 Lenti ORF clone of Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2, mGFP tagged 10 ug
$600.00
RC213744L3 Lenti ORF clone of Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2, Myc-DDK-tagged 10 ug
$600.00
RC213744L4 Lenti ORF clone of Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2, mGFP tagged 10 ug
$600.00
RG213744 CLEC12A (tGFP-tagged) - Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2 10 ug
$500.00
SC308074 CLEC12A (untagged)-Human C-type lectin domain family 12, member A (CLEC12A), transcript variant 2 10 ug
$300.00

Plasmid Map for RC213744

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC213744
Circular map for RC213744

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products