OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SETD4 (NM_017438) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC212740
SETD4 (Myc-DDK-tagged)-Human SET domain containing 4 (SETD4), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA335546 Rabbit Polyclonal Anti-SETD4 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SETD4 or NM_017438"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SETD4
Synonyms C21orf18; C21orf27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212740 representing NM_017438
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCAGAAAGGAAAAGGGAGAACAAGCCGGATCAGAAGACGAAAACTCTGCGGAAGTTCTGAATCAAGAG
GAGTGAATGAGAGCCACAAGTCTGAATTTATAGAGCTGAGGAAGTGGCTGAAAGCTAGGAAGTTTCAAGA
TTCAAACTTAGCGCCTGCTTGTTTTCCAGGTACAGGAAGAGGGCTGATGAGTCAAACATCCCTGCAGGAG
GGACAGATGATTATTTCGTTGCCTGAGAGTTGCCTGCTCACCACGGACACAGTGATTCGAAGCTACTTAG
GGGCATACATTACTAAGTGGAAGCCTCCTCCATCTCCTCTGCTGGCGCTGTGCACCTTTTTAGTTTCAGA
AAAGCATGCTGGGCACCGATCTCTTTGGAAGCCTTACCTGGAGATTTTACCCAAGGCGTATACCTGCCCT
GTTTGTTTGGAGCCGGAAGTGGTGAACCTTCTTCCCAAATCTTTAAAAGCAAAGGCTGAAGAGCAGAGAG
CCCACGTGCAGGAGTTCTTTGCTTCCTCCAGAGACTTTTTCTCTTCTCTGCAGCCTCTGTTTGCGGAGGC
TGTTGACAGCATCTTCAGCTACAGTGCCCTGCTGTGGGCTTGGTGCACCGTCAACACCAGAGCCGTGTAC
CTGAGGCCCAGGCAGCGGGAATGCCTTTCTGCAGAGCCGGACACCTGTGCACTCGCTCCGTACCTGGACC
TGCTGAATCATAGCCCACATGTCCAGGTAAAAGCAGCGTTTAATGAAGAAACTCATTCTTACGAAATTAG
AACGACTTCACGTTGGAGAAAGCATGAAGAGGTATTCATCTGTTACGGCCCTCACGATAATCAACGGCTG
TTCCTGGAATACGGATTTGTTTCTGTCCATAATCCTCATGCTTGTGTTTATGTCTCAAGAGAAATACTTG
TTAAATATCTTCCATCAACAGATAAACAGATGGACAAAAAGATTTCTATTTTAAAGGATCATGGCTATAT
AGAAAATTTGACATTTGGATGGGATGGACCATCTTGGAGGCTACTCACAGCCCTTAAGTTGTTATGTCTG
GAAGCTGAGAAATTTACATGCTGGAAAAAAGTACTTCTTGGGGAGGTAATTTCAGATACGAATGAGAAGA
CAAGTTTGGACATAGCCCAGAAAATATGCTATTATTTCATAGAAGAGACTAATGCTGTGCTTCAAAAGGT
GTCTCATATGAAGGATGAAAAAGAGGCCCTGATAAACCAACTAACTTTGGTGGAATCCTTGTGGACGGAA
GAGCTAAAGATTCTCAGGGCATCTGCCGAGACCCTGCACAGTTTGCAAACAGCTTTTACC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212740 representing NM_017438
Red=Cloning site Green=Tags(s)

MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNLAPACFPGTGRGLMSQTSLQE
GQMIISLPESCLLTTDTVIRSYLGAYITKWKPPPSPLLALCTFLVSEKHAGHRSLWKPYLEILPKAYTCP
VCLEPEVVNLLPKSLKAKAEEQRAHVQEFFASSRDFFSSLQPLFAEAVDSIFSYSALLWAWCTVNTRAVY
LRPRQRECLSAEPDTCALAPYLDLLNHSPHVQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRL
FLEYGFVSVHNPHACVYVSREILVKYLPSTDKQMDKKISILKDHGYIENLTFGWDGPSWRLLTALKLLCL
EAEKFTCWKKVLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTE
ELKILRASAETLHSLQTAFT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_017438
ORF Size 1320 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_017438.5
RefSeq Size 3360 bp
RefSeq ORF 1323 bp
Locus ID 54093
UniProt ID Q9NVD3
Cytogenetics 21q22.12
Domains SET
MW 50.2 kDa
Summary Histone-lysine N-methyltransferase that acts as a regulator of cell proliferation, cell differentiation and inflammatory response (PubMed:31308046). Regulates the inflammatory response by mediating mono- and dimethylation of 'Lys-4' of histone H3 (H3K4me1 and H3K4me2, respectively), leading to activate the transcription of proinflammatory cytokines IL6 and TNF-alpha (By similarity). Also involved in the regulation of stem cell quiescence by catalyzing the trimethylation of 'Lys-20' of histone H4 (H4K20me3), thereby promoting heterochromatin formation (PubMed:31308046). Involved in proliferation, migration, paracrine and myogenic differentiation of bone marrow mesenchymal stem cells (BMSCs) (By similarity).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_017438" in other vectors (6)
SKU Description Size Price
RC212740L1 Lenti ORF clone of Human SET domain containing 4 (SETD4), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC212740L2 Lenti ORF clone of Human SET domain containing 4 (SETD4), transcript variant 1, mGFP tagged 10 ug
$986.00
RC212740L3 Lenti ORF clone of Human SET domain containing 4 (SETD4), transcript variant 1, Myc-DDK-tagged 10 ug
$986.00
RC212740L4 Lenti ORF clone of Human SET domain containing 4 (SETD4), transcript variant 1, mGFP tagged 10 ug
$986.00
RG212740 SETD4 (tGFP-tagged) - Human SET domain containing 4 (SETD4), transcript variant 1 10 ug
$886.00
SC313482 SETD4 (untagged)-Human SET domain containing 4 (SETD4), transcript variant 1 10 ug
$686.00

Plasmid Map for RC212740

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC212740
Circular map for RC212740

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products