OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DDT (NM_001084392) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC212637
DDT (Myc-DDK-tagged)-Human D-dopachrome tautomerase (DDT), transcript variant 2
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA505604 DDT mouse monoclonal antibody, clone OTI1H3 (formerly 1H3) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DDT or NM_001084392"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DDT
Synonyms D-DT; DDCT; MIF-2; MIF2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC212637 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGTTCCTGGAGCTGGACACGAATTTGCCCGCCAACCGAGTGCCCGCGGGGCTGGAGAAACGACTCT
GCGCCGCCGCTGCCTCCATCCTGGGCAAACCTGCGGACCGCGTGAACGTGACGGTACGGCCGGGCCTGGC
CATGGCGCTGAGCGGGTCCACCGAGCCCTGCGCGCAGCTGTCCATCTCCTCCATCGGCGTAGTGGGCACC
GCCGAGGACAACCGCAGCCACAGCGCCCACTTCTTTGAGTTTCTCACCAAGGAGCTAGCCCTGGGCCAGG
ACCGGATACTTATCCGCTTTTTCCCCTTGGAGTCCTGGCAGATTGGCAAGATAGGGACGGTCATGACTTT
TTTA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC212637 protein sequence
Red=Cloning site Green=Tags(s)

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT
AEDNRSHSAHFFEFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001084392
ORF Size 354 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001084392.3
RefSeq Size 637 bp
RefSeq ORF 357 bp
Locus ID 1652
UniProt ID P30046, Q53Y51
Cytogenetics 22q11.23
MW 12.7 kDa
Summary D-dopachrome tautomerase converts D-dopachrome into 5,6-dihydroxyindole. The DDT gene is related to the migration inhibitory factor (MIF) in terms of sequence, enzyme activity, and gene structure. DDT and MIF are closely linked on chromosome 22. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001084392" in other vectors (4)
SKU Description Size Price
RC212637L3 Lenti ORF clone of Human D-dopachrome tautomerase (DDT), transcript variant 2, Myc-DDK-tagged 10 ug
$450.00
RC212637L4 Lenti ORF clone of Human D-dopachrome tautomerase (DDT), transcript variant 2, mGFP tagged 10 ug
$450.00
RG212637 DDT (tGFP-tagged) - Human D-dopachrome tautomerase (DDT), transcript variant 2 10 ug
$350.00
SC316120 DDT (untagged)-Human D-dopachrome tautomerase (DDT), transcript variant 2 10 ug
$165.00

Plasmid Map for RC212637

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC212637
Circular map for RC212637

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products