OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IL36RN (NM_012275) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC211691
IL36RN (Myc-DDK-tagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA326668 Rabbit Polyclonal IL-36RN Antibody
100 ug
$640.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IL36RN or NM_012275"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IL36RN
Synonyms FIL1; FIL1(DELTA); FIL1D; IL-36Ra; IL1F5; IL1HY1; IL1L1; IL1RP3; IL36RA; PSORP; PSORS14
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211691 representing NM_012275
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTCCTGAGTGGGGCGCTGTGCTTCCGAATGAAGGACTCGGCATTGAAGGTGCTTTATCTGCATAATA
ACCAGCTTCTAGCTGGAGGGCTGCATGCAGGGAAGGTCATTAAAGGTGAAGAGATCAGCGTGGTCCCCAA
TCGGTGGCTGGATGCCAGCCTGTCCCCCGTCATCCTGGGTGTCCAGGGTGGAAGCCAGTGCCTGTCATGT
GGGGTGGGGCAGGAGCCGACTCTAACACTAGAGCCAGTGAACATCATGGAGCTCTATCTTGGTGCCAAGG
AATCCAAGAGCTTCACCTTCTACCGGCGGGACATGGGGCTCACCTCCAGCTTCGAGTCGGCTGCCTACCC
GGGCTGGTTCCTGTGCACGGTGCCTGAAGCCGATCAGCCTGTCAGACTCACCCAGCTTCCCGAGAATGGT
GGCTGGAATGCCCCCATCACAGACTTCTACTTCCAGCAGTGTGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211691 representing NM_012275
Red=Cloning site Green=Tags(s)

MVLSGALCFRMKDSALKVLYLHNNQLLAGGLHAGKVIKGEEISVVPNRWLDASLSPVILGVQGGSQCLSC
GVGQEPTLTLEPVNIMELYLGAKESKSFTFYRRDMGLTSSFESAAYPGWFLCTVPEADQPVRLTQLPENG
GWNAPITDFYFQQCD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012275
ORF Size 465 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012275.3
RefSeq Size 2717 bp
RefSeq ORF 468 bp
Locus ID 26525
UniProt ID Q9UBH0
Cytogenetics 2q14.1
Domains IL1
Protein Families Druggable Genome, Secreted Protein
MW 16.8 kDa
Summary The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine was shown to specifically inhibit the activation of NF-kappaB induced by interleukin 1 family, member 6 (IL1F6). This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding the same protein have been reported. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012275" in other vectors (6)
SKU Description Size Price
RC211691L1 Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC211691L2 Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, mGFP tagged 10 ug
$450.00
RC211691L3 Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, Myc-DDK-tagged 10 ug
$450.00
RC211691L4 Lenti ORF clone of Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1, mGFP tagged 10 ug
$450.00
RG211691 IL36RN (tGFP-tagged) - Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 10 ug
$489.00
SC115434 IL36RN (untagged)-Human interleukin 1 family, member 5 (delta) (IL1F5), transcript variant 1 10 ug
$150.00

Plasmid Map for RC211691

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211691
Circular map for RC211691

file-alt Citations

Investigating Mechanisms of Immune Function and New Therapeutic Targets in Rare Autoimmune Diseases
Hecker
Thesis (2024)
Snippet: Plasmid Company Catalog number IL36RN (NM_173170) Human Tagged ORF Clone pCMV entry Origene, Rockville, USA RC211691 pCMV6-Entry IL36RN S113L Plasmid Addgene, Watertown, USA 58321 pET-(IL36RA) VectorBuilder, Chicago, USA VB220506-1124dka (Vector ID)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products