OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

5HT5A receptor (HTR5A) (NM_024012) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC211300
HTR5A (Myc-DDK-tagged)-Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA314045 Rabbit polyclonal anti-HTR5A antibody
100 ul
$380.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "5HT5A receptor or NM_024012"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol 5HT5A receptor
Synonyms 5-HT5A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211300 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATTTACCTGTGAACCTAACCTCCTTTTCCCTCTCCACCCCCTCCCCTTTGGAGACCAACCACAGCC
TCGGCAAAGACGACCTGCGCCCCAGCTCGCCCCTGCTCTCGGTCTTCGGAGTGCTTATTCTCACCTTGCT
GGGCTTTCTGGTGGCGGCGACGTTCGCCTGGAACCTGCTGGTGCTGGCGACCATCCTCCGTGTACGCACC
TTCCACCGCGTGCCCCACAACCTGGTGGCATCCATGGCCGTCTCGGATGTCCTGGTGGCCGCGCTGGTCA
TGCCGCTGAGCCTGGTGCACGAGCTGTCCGGGCGCCGCTGGCAGCTAGGTCGGAGGCTGTGCCAGCTTTG
GATCGCGTGCGACGTGCTTTGCTGCACGGCCAGCATCTGGAACGTGACGGCCATAGCCCTGGACCGCTAC
TGGTCCATCACGCGCCACATGGAATACACGCTCCGCACCCGCAAGTGCGTCTCCAACGTCATGATCGCGC
TCACCTGGGCACTCTCCGCTGTCATCTCTCTGGCCCCGCTGCTTTTTGGCTGGGGAGAGACGTACTCTGA
GGGCAGCGAGGAGTGCCAGGTAAGCCGCGAGCCTTCCTACGCCGTGTTCTCCACCGTAGGCGCCTTCTAC
CTGCCGCTCTGTGTGGTGCTCTTCGTGTACTGGAAGATCTACAAGGCTGCCAAGTTCCGCGTGGGCTCCA
GGAAGACCAATAGCGTCTCACCCATATCCGAAGCTGTGGAGGTGAAGGACTCTGCCAAACAGCCCCAGAT
GGTGTTCACGGTCCGCCACGCCACCGTCACCTTCCAGCCAGAAGGGGACACGTGGCGGGAGCAGAAGGAG
CAGCGGGCCGCCCTCATGGTGGGCATCCTCATTGGCGTGTTCGTGCTCTGCTGGATCCCCTTCTTTCTCA
CCGAGCTCATCAGTCCCCTCTGCTCCTGTGACATCCCCGCCATCTGGAAAAGCATCTTCCTGTGGCTTGG
CTACTCCAACTCCTTCTTTAACCCCCTGATCTATACGGCTTTCAACAAGAACTACAACAGCGCCTTCAAG
AACTTCTTTTCTAGGCAACAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211300 protein sequence
Red=Cloning site Green=Tags(s)

MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLLVLATILRVRT
FHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIACDVLCCTASIWNVTAIALDRY
WSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFGWGETYSEGSEECQVSREPSYAVFSTVGAFY
LPLCVVLFVYWKIYKAAKFRVGSRKTNSVSPISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKE
QRAALMVGILIGVFVLCWIPFFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFK
NFFSRQH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024012
ORF Size 1071 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024012.4
RefSeq Size 4572 bp
RefSeq ORF 1074 bp
Locus ID 3361
UniProt ID P47898, A4D2N2
Cytogenetics 7q36.2
Domains 7tm_1
Protein Families Druggable Genome, GPCR, Transmembrane
Protein Pathways Calcium signaling pathway, Neuroactive ligand-receptor interaction
MW 40.3 kDa
Summary The neurotransmitter serotonin (5-hydroxytryptamine, 5-HT) has been implicated in a wide range of psychiatric conditions and also has vasoconstrictive and vasodilatory effects. The gene described in this record is a member of 5-hydroxytryptamine (serotonin) receptor family and encodes a multi-pass membrane protein that functions as a receptor for 5-hydroxytryptamine and couples to G-proteins. This protein has been shown to function in part through the regulation of intracellular Ca2+ mobilization. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024012" in other vectors (6)
SKU Description Size Price
RC211300L1 Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A), Myc-DDK-tagged 10 ug
$757.00
RC211300L2 Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A), mGFP tagged 10 ug
$757.00
RC211300L3 Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A), Myc-DDK-tagged 10 ug
$757.00
RC211300L4 Lenti ORF clone of Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A), mGFP tagged 10 ug
$757.00
RG211300 HTR5A (tGFP-tagged) - Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A) 10 ug
$489.00 $657.00
SC112321 HTR5A (untagged)-Human 5-hydroxytryptamine (serotonin) receptor 5A (HTR5A) 10 ug
$457.00

Plasmid Map for RC211300

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211300
Circular map for RC211300

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products