OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD153 (TNFSF8) (NM_001244) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC211276
TNFSF8 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA358538 TNFSF8 Antibody - N-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CD153 or NM_001244"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD153
Synonyms CD30L; CD30LG; CD153; TNLG3A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211276 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACCCAGGGCTGCAGCAAGCACTCAACGGAATGGCCCCTCCTGGAGACACAGCCATGCATGTGCCGG
CGGGCTCCGTGGCCAGCCACCTGGGGACCACGAGCCGCAGCTATTTCTATTTGACCACAGCCACTCTGGC
TCTGTGCCTTGTCTTCACGGTGGCCACTATTATGGTGTTGGTCGTTCAGAGGACGGACTCCATTCCCAAC
TCACCTGACAACGTCCCCCTCAAAGGAGGAAATTGCTCAGAAGACCTCTTATGTATCCTGAAAAGGGCTC
CATTCAAGAAGTCATGGGCCTACCTCCAAGTGGCAAAGCATCTAAACAAAACCAAGTTGTCTTGGAACAA
AGATGGCATTCTCCATGGAGTCAGATATCAGGATGGGAATCTGGTGATCCAATTCCCTGGTTTGTACTTC
ATCATTTGCCAACTGCAGTTTCTTGTACAATGCCCAAATAATTCTGTCGATCTGAAGTTGGAGCTTCTCA
TCAACAAGCATATCAAAAAACAGGCCCTGGTGACAGTGTGTGAGTCTGGAATGCAAACGAAACACGTATA
CCAGAATCTCTCTCAATTCTTGCTGGATTACCTGCAGGTCAACACCACCATATCAGTCAATGTGGATACA
TTCCAGTACATAGATACAAGCACCTTTCCTCTTGAGAATGTGTTGTCCATCTTCTTATACAGTAATTCAG
AC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211276 protein sequence
Red=Cloning site Green=Tags(s)

MDPGLQQALNGMAPPGDTAMHVPAGSVASHLGTTSRSYFYLTTATLALCLVFTVATIMVLVVQRTDSIPN
SPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYF
IICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDT
FQYIDTSTFPLENVLSIFLYSNSD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001244
ORF Size 702 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001244.3
RefSeq Size 3797 bp
RefSeq ORF 705 bp
Locus ID 944
UniProt ID P32971, Q52M88
Cytogenetics 9q32-q33.1
Domains TNF
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cytokine-cytokine receptor interaction
MW 26 kDa
Summary The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2011
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001244" in other vectors (6)
SKU Description Size Price
RC211276L1 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8), Myc-DDK-tagged 10 ug
$600.00
RC211276L2 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8), mGFP tagged 10 ug
$600.00
RC211276L3 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8), Myc-DDK-tagged 10 ug
$600.00
RC211276L4 Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8), mGFP tagged 10 ug
$600.00
RG211276 TNFSF8 (tGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) 10 ug
$489.00 $500.00
SC119372 TNFSF8 (untagged)-Human tumor necrosis factor (ligand) superfamily, member 8 (TNFSF8) 10 ug
$300.00

Plasmid Map for RC211276

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211276
Circular map for RC211276

file-alt Citations

The Opposite Functions of CD30 Ligand Isoforms
Printsev, Alalli, Bilsborough
Curr Issues Mol Biol (2024) 46 (3), 2741-2756 DOI: 10.3390/cimb46030172
Cited by 1
AI Summary: OriGene contributed to this study by providing open reading frames (ORFs) for both CD30 ligand isoforms (RC211276 and RC231923), enabling the researchers to investigate the distinct functions of each isoform.
Snippet: sed using the Attune NxT Flow Cytometer and AutoSampler (ThermoFisher, Waltham, MA, USA). 2.7. Expression of CD30L Isoforms Open reading frames (ORFs) for both the CD30L isoforms were purchased from Origene (RC211276, RC231923, Rockville, MD, USA), containing C-terminal FLAG/MYC epitope tags. ORFs were subcloned into the pcDNA5/FRT/TO (ThermoFisher V652020, Waltham, MA, USA) vector with or withou
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products