OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B4GALT5 (NM_004776) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC211225
B4GALT5 (Myc-DDK-tagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA365233 B4GALT5 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "B4GALT5 or NM_004776"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol B4GALT5
Synonyms B4Gal-T5; BETA4-GALT-IV; beta4Gal-T5; beta4GalT-V; gt-V
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211225 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGCGCCCGCCGGGGGCTGCTGCGGCTGCCGCGCCGCTCGCTGCTCGCCGCGCTCTTCTTCTTTTCTC
TCTCGTCCTCGCTGCTGTACTTCGTCTATGTGGCGCCCGGCATAGTGAACACCTACCTCTTCATGATGCA
AGCCCAAGGCATTCTGATCCGGGACAACGTGAGAACAATCGGTGCTCAGGTTTATGAGCAGGTGCTTCGG
AGTGCTTATGCCAAGAGGAACAGCAGTGTAAATGACTCAGATTATCCTCTTGACTTGAACCACAGTGAAA
CCTTCCTGCAAACTACAACATTTCTTCCTGAAGACTTCACCTACTTTGCAAACCATACCTGCCCTGAAAG
ACTCCCTTCCATGAAGGGCCCAATAGACATAAACATGAGTGAAATTGGAATGGATTACATTCATGAACTC
TTCTCCAAAGACCCAACCATCAAGCTCGGAGGTCACTGGAAGCCTTCTGATTGCATGCCTCGGTGGAAGG
TGGCGATCCTTATCCCCTTCCGGAACCGCCACGAGCACCTCCCAGTCCTGTTCAGACACCTGCTTCCCAT
GCTCCAGCGCCAGCGCTTGCAGTTTGCATTTTATGTGGTTGAACAAGTTGGTACCCAACCCTTTAATCGA
GCCATGCTTTTCAACGTTGGCTTTCAAGAGGCAATGAAAGACTTGGATTGGGACTGTTTGATTTTTCATG
ATGTAGATCACATACCGGAAAGTGATCGCAACTATTATGGATGTGGACAGATGCCGAGGCATTTTGCAAC
CAAATTGGATAAGTATATGTATCTGCTTCCTTATACCGAGTTCTTTGGCGGAGTGAGTGGCTTAACAGTG
GAACAATTTCGGAAAATCAATGGCTTTCCTAATGCTTTCTGGGGTTGGGGTGGAGAAGATGACGACCTCT
GGAACAGAGTACAGAATGCAGGCTATTCTGTGAGCCGGCCAGAGGGTGACACAGGAAAGTACAAGTCCAT
TCCTCATCACCATCGAGGAGAAGTCCAGTTTCTTGGAAGGTATGCTCTGCTGAGGAAGTCAAAAGAACGG
CAAGGGCTGGATGGCCTCAACAACCTGAACTACTTTGCAAACATCACATACGACGCCTTGTATAAAAACA
TAACTGTCAACCTGACACCCGAGCTGGCTCAGGTGAACGAGTAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211225 protein sequence
Red=Cloning site Green=Tags(s)

MRARRGLLRLPRRSLLAALFFFSLSSSLLYFVYVAPGIVNTYLFMMQAQGILIRDNVRTIGAQVYEQVLR
SAYAKRNSSVNDSDYPLDLNHSETFLQTTTFLPEDFTYFANHTCPERLPSMKGPIDINMSEIGMDYIHEL
FSKDPTIKLGGHWKPSDCMPRWKVAILIPFRNRHEHLPVLFRHLLPMLQRQRLQFAFYVVEQVGTQPFNR
AMLFNVGFQEAMKDLDWDCLIFHDVDHIPESDRNYYGCGQMPRHFATKLDKYMYLLPYTEFFGGVSGLTV
EQFRKINGFPNAFWGWGGEDDDLWNRVQNAGYSVSRPEGDTGKYKSIPHHHRGEVQFLGRYALLRKSKER
QGLDGLNNLNYFANITYDALYKNITVNLTPELAQVNEY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004776
ORF Size 1164 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004776.4
RefSeq Size 4743 bp
RefSeq ORF 1167 bp
Locus ID 9334
UniProt ID O43286
Cytogenetics 20q13.13
Domains Galactosyl_T_2
Protein Families Transmembrane
Protein Pathways O-Glycan biosynthesis
MW 45.1 kDa
Summary This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The function of the enzyme encoded by this gene is not clear. This gene was previously designated as B4GALT4 but was renamed to B4GALT5. In the literature it is also referred to as beta4GalT2. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004776" in other vectors (6)
SKU Description Size Price
RC211225L1 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5), Myc-DDK-tagged 10 ug
$757.00
RC211225L2 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5), mGFP tagged 10 ug
$757.00
RC211225L3 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5), Myc-DDK-tagged 10 ug
$757.00
RC211225L4 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5), mGFP tagged 10 ug
$757.00
RG211225 B4GALT5 (tGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5) 10 ug
$657.00
SC117170 B4GALT5 (untagged)-Human UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 5 (B4GALT5) 10 ug
$457.00

Plasmid Map for RC211225

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211225
Circular map for RC211225

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products