OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

PGK1 (NM_000291) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC211172
PGK1 (Myc-DDK-tagged)-Human phosphoglycerate kinase 1 (PGK1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
2 Weeks*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349646 Rabbit Polyclonal Anti-PGK1 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "PGK1 or NM_000291"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol PGK1
Synonyms HEL-S-68p; MIG10; PGKA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC211172 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGCTTTCTAACAAGCTGACGCTGGACAAGCTGGACGTTAAAGGGAAGCGGGTCGTTATGAGAGTCG
ACTTCAATGTTCCTATGAAGAACAACCAGATAACAAACAACCAGAGGATTAAGGCTGCTGTCCCAAGCAT
CAAATTCTGCTTGGACAATGGAGCCAAGTCGGTAGTCCTTATGAGCCACCTAGGCCGGCCTGATGGTGTG
CCCATGCCTGACAAGTACTCCTTAGAGCCAGTTGCTGTAGAACTCAAATCTCTGCTGGGCAAGGATGTTC
TGTTCTTGAAGGACTGTGTAGGCCCAGAAGTGGAGAAAGCCTGTGCCAACCCAGCTGCTGGGTCTGTCAT
CCTGCTGGAGAACCTCCGCTTTCATGTGGAGGAAGAAGGGAAGGGAAAAGATGCTTCTGGGAACAAGGTT
AAAGCCGAGCCAGCCAAAATAGAAGCTTTCCGAGCTTCACTTTCCAAGCTAGGGGATGTCTATGTCAATG
ATGCTTTTGGCACTGCTCACAGAGCCCACAGCTCCATGGTAGGAGTCAATCTGCCACAGAAGGCTGGTGG
GTTTTTGATGAAGAAGGAGCTGAACTACTTTGCAAAGGCCTTGGAGAGCCCAGAGCGACCCTTCCTGGCC
ATCCTGGGCGGAGCTAAAGTTGCAGACAAGATCCAGCTCATCAATAATATGCTGGACAAAGTCAATGAGA
TGATTATTGGTGGTGGAATGGCTTTTACCTTCCTTAAGGTGCTCAACAACATGGAGATTGGCACTTCTCT
GTTTGATGAAGAGGGAGCCAAGATTGTCAAAGACCTAATGTCCAAAGCTGAGAAGAATGGTGTGAAGATT
ACCTTGCCTGTTGACTTTGTCACTGCTGACAAGTTTGATGAGAATGCCAAGACTGGCCAAGCCACTGTGG
CTTCTGGCATACCTGCTGGCTGGATGGGCTTGGACTGTGGTCCTGAAAGCAGCAAGAAGTATGCTGAGGC
TGTCACTCGGGCTAAGCAGATTGTGTGGAATGGTCCTGTGGGGGTATTTGAATGGGAAGCTTTTGCCCGG
GGAACCAAAGCTCTCATGGATGAGGTGGTGAAAGCCACTTCTAGGGGCTGCATCACCATCATAGGTGGTG
GAGACACTGCCACTTGCTGTGCCAAATGGAACACGGAGGATAAAGTCAGCCATGTGAGCACTGGGGGTGG
TGCCAGTTTGGAGCTCCTGGAAGGTAAAGTCCTTCCTGGGGTGGATGCTCTCAGCAATATT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC211172 protein sequence
Red=Cloning site Green=Tags(s)

MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVLMSHLGRPDGV
PMPDKYSLEPVAVELKSLLGKDVLFLKDCVGPEVEKACANPAAGSVILLENLRFHVEEEGKGKDASGNKV
KAEPAKIEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVNLPQKAGGFLMKKELNYFAKALESPERPFLA
ILGGAKVADKIQLINNMLDKVNEMIIGGGMAFTFLKVLNNMEIGTSLFDEEGAKIVKDLMSKAEKNGVKI
TLPVDFVTADKFDENAKTGQATVASGIPAGWMGLDCGPESSKKYAEAVTRAKQIVWNGPVGVFEWEAFAR
GTKALMDEVVKATSRGCITIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKVLPGVDALSNI

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_000291
ORF Size 1251 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_000291.4
RefSeq Size 2439 bp
RefSeq ORF 1254 bp
Locus ID 5230
UniProt ID P00558, V9HWF4
Cytogenetics Xq21.1
Domains PGK
Protein Families Druggable Genome
Protein Pathways Glycolysis / Gluconeogenesis, Metabolic pathways
MW 44.6 kDa
Summary The protein encoded by this gene is a glycolytic enzyme that catalyzes the conversion of 1,3-diphosphoglycerate to 3-phosphoglycerate. The encoded protein may also act as a cofactor for polymerase alpha. Additionally, this protein is secreted by tumor cells where it participates in angiogenesis by functioning to reduce disulfide bonds in the serine protease, plasmin, which consequently leads to the release of the tumor blood vessel inhibitor angiostatin. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. Deficiency of the enzyme is associated with a wide range of clinical phenotypes hemolytic anemia and neurological impairment. Pseudogenes of this gene have been defined on chromosomes 19, 21 and the X chromosome. provided by RefSeq, Jan 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_000291" in other vectors (6)
SKU Description Size Price
RC211172L1 Lenti ORF clone of Human phosphoglycerate kinase 1 (PGK1), Myc-DDK-tagged 10 ug
$757.00
RC211172L2 Lenti ORF clone of Human phosphoglycerate kinase 1 (PGK1), mGFP tagged 10 ug
$757.00
RC211172L3 Lenti ORF clone of Human phosphoglycerate kinase 1 (PGK1), Myc-DDK-tagged 10 ug
$757.00
RC211172L4 Lenti ORF clone of Human phosphoglycerate kinase 1 (PGK1), mGFP tagged 10 ug
$757.00
RG211172 PGK1 (tGFP-tagged) - Human phosphoglycerate kinase 1 (PGK1) 10 ug
$489.00 $657.00
SC119988 PGK1 (untagged)-Human phosphoglycerate kinase 1 (PGK1) 10 ug
$457.00

Plasmid Map for RC211172

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC211172
Circular map for RC211172

file-alt Citations

HPV16 E6/E7 stabilize PGK1 protein by reducing its poly-ubiquitination in cervical cancer
Liu, Song, Yao et al
Cell Biol Int (2021)
Cited by 16
AI Summary: OriGene Technologies contributed to this study by providing the Human Tagged ORF Clone of PGK1 (Cat# RC211172), which was used to overexpress PGK1 in cervical cancer cell models to investigate its role in cell proliferation, glycolysis, migration, and invasion.
Snippet: acids) from UBB cDNA into the pCMV-HA vector between the EcoRI/KpnI sites. The Human Tagged ORF Clone of PGK1 (NM_000291, AT#: RC211172) (PGK1-OE) was purchased from OriGene Technologies. In brief, the complete CDS fragment of PGK1 was subcloned into the pCMV6-Entry vector. Transfection of overexpression plasmids was performed using Lipofectamine 3000 (Thermo
A metabolite-derived protein modification integrates glycolysis with KEAP1-NRF2 signalling
Bollong, Lee, Coukos et al
Nature (2018) 562 (7728), 600-604 DOI: 10.1038/s41586-018-0622-0
AI Summary: OriGene’s full-length human PGK1 (NM_000291) plasmid was used for transient expression of PGK1 protein, enabling functional studies that linked glycolysis to KEAP1-NRF2 signalling in this research.
Snippet: Full-length, human PGK1 (NM_000291, Origene) transiently expressed from a pCMV6 entry vector with a C-terminal Myc-DDK tag;full-length, human KEAP1 (28023, Addgene) was transiently expressed from a pcDNA/FRT/TO plasmid with a C-terminal 3×Flag tag. All references to Flag–PGK1 or Flag–KEAP1 represent the proteins in the aforementioned vectors, respectively
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products