OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HSDL2 (NM_032303) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210663
HSDL2 (Myc-DDK-tagged)-Human hydroxysteroid dehydrogenase like 2 (HSDL2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "HSDL2 or NM_032303"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol HSDL2
Synonyms C9orf99; SDR13C1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210663 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTACCCAACACCGGGAGGCTGGCAGGATGTACAGTTTTTATCACAGGTGCAAGCCGTGGCATTGGCA
AAGCTATTGCATTGAAAGCAGCAAAGGATGGAGCAAATATTGTTATTGCTGCAAAGACCGCCCAGCCACA
TCCAAAACTTCTAGGCACAATCTATACTGCTGCTGAAGAAATTGAAGCAGTTGGAGGAAAGGCCTTGCCA
TGTATTGTTGATGTGAGAGATGAACAGCAGATCAGTGCTGCAGTGGAGAAAGCCATCAAGAAATTTGGAG
GAATTGATATTCTGGTAAATAATGCCAGTGCCATTAGTTTGACCAATACATTGGACACACCTACCAAGAG
ATTGGATCTGATGATGAACGTGAACACCAGAGGCACCTACCTTGCATCTAAAGCATGTATTCCTTATTTG
AAAAAGAGCAAAGTTGCTCATATCCTCAATATCAGTCCACCACTGAACCTAAATCCAGTTTGGTTCAAAC
AGCACTGTGCTTATACCATTGCTAAGTATGGTATGTCTATGTATGTGCTTGGAATGGCAGAAGAATTTAA
AGGTGAAATTGCAGTCAATGCATTATGGCCTAAAACAGCCATACACACTGCTGCTATGGATATGCTGGGA
GGACCTGGTATCGAAAGCCAGTGTAGAAAAGTTGATATCATTGCAGATGCAGCATATTCCATTTTCCAAA
AGCCAAAAAGTTTTACTGGCAACTTTGTCATTGATGAAAATATCTTAAAAGAAGAAGGAATAGAAAATTT
TGACGTTTATGCAATTAAACCAGGTCATCCTTTGCAACCAGATTTCTTCTTAGATGAATACCCAGAAGCA
GTTAGCAAGAAAGTGGAATCAACTGGTGCTGTTCCAGAATTCAAAGAAGAGAAACTGCAGCTGCAACCAA
AACCACGTTCTGGAGCTGTGGAAGAAACATTTAGAATTGTTAAGGACTCTCTCAGTGATGATGTTGTTAA
AGCCACTCAAGCAATCTATCTGTTTGAACTCTCCGGTGAAGATGGTGGCACGTGGTTTCTTGATCTGAAA
AGCAAGGGTGGGAATGTCGGATATGGAGAGCCTTCTGATCAGGCAGATGTGGTGATGAGTATGACTACTG
ATGACTTTGTAAAAATGTTTTCAGGGAAACTAAAACCAACAATGGCATTCATGTCAGGGAAATTGAAGAT
TAAAGGTAACATGGCCCTAGCAATCAAATTGGAGAAGCTAATGAATCAGATGAATGCCAGACTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210663 protein sequence
Red=Cloning site Green=Tags(s)

MLPNTGRLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQPHPKLLGTIYTAAEEIEAVGGKALP
CIVDVRDEQQISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPYL
KKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGEIAVNALWPKTAIHTAAMDMLG
GPGIESQCRKVDIIADAAYSIFQKPKSFTGNFVIDENILKEEGIENFDVYAIKPGHPLQPDFFLDEYPEA
VSKKVESTGAVPEFKEEKLQLQPKPRSGAVEETFRIVKDSLSDDVVKATQAIYLFELSGEDGGTWFLDLK
SKGGNVGYGEPSDQADVVMSMTTDDFVKMFSGKLKPTMAFMSGKLKIKGNMALAIKLEKLMNQMNARL

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_032303
ORF Size 1254 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_032303.5
RefSeq Size 3393 bp
RefSeq ORF 1257 bp
Locus ID 84263
UniProt ID Q6YN16
Cytogenetics 9q32
Domains SCP2
Protein Families Druggable Genome
MW 45.4 kDa
Summary Has apparently no steroid dehydrogenase activity.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_032303" in other vectors (4)
SKU Description Size Price
RC210663L3 Lenti ORF clone of Human hydroxysteroid dehydrogenase like 2 (HSDL2), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC210663L4 Lenti ORF clone of Human hydroxysteroid dehydrogenase like 2 (HSDL2), transcript variant 1, mGFP tagged 10 ug
$757.00
RG210663 HSDL2 (tGFP-tagged) - Human hydroxysteroid dehydrogenase like 2 (HSDL2), transcript variant 1 10 ug
$657.00
SC319859 HSDL2 (untagged)-Human hydroxysteroid dehydrogenase like 2 (HSDL2), transcript variant 1 10 ug
$457.00

Plasmid Map for RC210663

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210663
Circular map for RC210663

file-alt Citations

Lipid metabolism regulator human hydroxysteroid dehydrogenase-like 2 (HSDL2) modulates cervical cancer cell proliferation and metastasis
Yang, Han, Wang et al
J Cell Mol Med (2021)
Cited by 41
AI Summary: OriGene contributed to this study by providing the pCMV6-HSDL2 overexpression plasmid, which was used to investigate the role of HSDL2 in cervical cancer cell proliferation and metastasis.
Snippet: …pCMV6- HSDL2 overexpression plasmid was ac- quired from Origene (Rockville, USA). The HSDL2;- GCAGCAAAGGATGGAGCAA- 3ʹ. … pCMV6- HSDL2 overexpression plasmid was ac- quired from Origene (Rockville, USA). The HSDL2
Ectopic expression of HSDL2 is related to cell proliferation and prognosis in breast cancer
Dong, Yang, Han et al
Cancer Manag Res (2019) 11, 6531-6542 DOI: 10.2147/CMAR.S205316
AI Summary: OriGene’s pCMV6-HSDL2 overexpression plasmid was used in this study to investigate the effects of HSDL2 overexpression on breast cancer cell proliferation and prognosis.
Snippet: controls (si-Control). All sequences (Table 1) were designed and synthesized by RiboBio (Guangzhou, China). pCMV6-HSDL2 overexpression plasmid was purchased from Origene (Rockville, USA). Transfections were performed
FigureFigureFigure
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products