ATP1A4 (NM_001001734) Human Tagged ORF Clone

SKU
RC210547
ATP1A4 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 4 polypeptide (ATP1A4), transcript variant 2
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$289.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ATP1A4
Synonyms ATP1A1; ATP1AL2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210547 representing NM_001001734
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATCCAGGCTCTGGCTGGATTCTTTACCTACTTTGTAATCCTGGCTGAGAATGGTTTTAGGCCTGTTG
ATCTGCTGGGCATCCGCCTCCACTGGGAAGATAAATACTTGAATGACCTGGAGGACAGCTACGGACAGCA
GTGGACCTATGAGCAACGAAAAGTTGTGGAGTTCACATGCCAAACGGCCTTTTTTGTCACCATCGTGGTT
GTGCAGTGGGCGGATCTCATCATCTCCAAGACTCGCCGCAACTCACTTTTCCAGCAGGGCATGAGAAACA
AAGTCTTAATATTTGGGATCCTGGAGGAGACACTCTTGGCTGCATTTCTGTCCTACACTCCAGGCATGGA
CGTGGCCCTGCGAATGTACCCACTCAAGATAACCTGGTGGCTCTGTGCCATTCCCTACAGTATTCTCATC
TTCGTCTATGATGAAATCAGAAAACTCCTCATCCGTCAGCACCCGGATGGCTGGGTGGAAAGGGAGACGT
ACTAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC210547 representing NM_001001734
Red=Cloning site Green=Tags(s)

MIQALAGFFTYFVILAENGFRPVDLLGIRLHWEDKYLNDLEDSYGQQWTYEQRKVVEFTCQTAFFVTIVV
VQWADLIISKTRRNSLFQQGMRNKVLIFGILEETLLAAFLSYTPGMDVALRMYPLKITWWLCAIPYSILI
FVYDEIRKLLIRQHPDGWVERETYY

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001001734
ORF Size 495 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001001734.1, NP_001001734.1
RefSeq Size 951 bp
RefSeq ORF 498 bp
Locus ID 480
UniProt ID Q13733
Cytogenetics 1q23.2
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cardiac muscle contraction
MW 20.1 kDa
Summary The protein encoded by this gene belongs to the family of P-type cation transport ATPases, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The catalytic subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes an alpha 4 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:ATP1A4 (NM_001001734) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC210547L3 Lenti-ORF clone of ATP1A4 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 4 polypeptide (ATP1A4), transcript variant 2 10 ug
$450.00
RC210547L4 Lenti-ORF clone of ATP1A4 (mGFP-tagged)-Human ATPase, Na+/K+ transporting, alpha 4 polypeptide (ATP1A4), transcript variant 2 10 ug
$450.00
RG210547 ATP1A4 (tGFP-tagged) - Human ATPase, Na+/K+ transporting, alpha 4 polypeptide (ATP1A4), transcript variant 2 10 ug
$350.00
SC321721 ATP1A4 (untagged)-Human ATPase, Na+/K+ transporting, alpha 4 polypeptide (ATP1A4), transcript variant 2 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.