OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GPS2 (NM_004489) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC210464
GPS2 (Myc-DDK-tagged)-Human G protein pathway suppressor 2 (GPS2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA359218 GPS2 Antibody - C-terminal region
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GPS2 or NM_004489"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GPS2
Synonyms AMF-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC210464 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCGCACTCCTGGAGCGCCCCAAGCTTTCCAACGCCATGGCCAGGGCGCTGCACCGGCACATTATGA
TGGAGCGGGAGCGCAAGCGGCAGGAGGAAGAAGAGGTGGATAAGATGATGGAACAGAAGATGAAGGAAGA
ACAGGAGAGAAGGAAGAAAAAGGAGATGGAAGAGAGAATGTCATTAGAGGAGACCAAGGAACAAATTCTG
AAGTTGGAGGAGAAGCTTTTGGCTCTACAGGAAGAGAAGCACCAGCTTTTCCTGCAGCTCAAGAAAGTTT
TACATGAGGAAGAAAAACGGAGGCGAAAGGAACAGAGTGACCTGACCACCCTAACATCAGCTGCATACCA
GCAGAGCCTGACTGTTCACACAGGAACTCATCTCCTCAGCATGCAGGGGAGCCCTGGAGGACACAATCGC
CCAGGCACCCTCATGGCAGCTGACAGAGCCAAACAAATGTTTGGACCCCAAGTGCTTACGACCCGGCACT
ACGTGGGCTCAGCAGCTGCTTTTGCAGGGACACCAGAGCATGGACAATTCCAAGGCAGTCCTGGTGGTGC
CTATGGGACTGCTCAGCCCCCACCTCACTATGGGCCCACACAGCCAGCTTATAGTCCTAGTCAGCAGCTC
AGAGCTCCTTCGGCATTCCCTGCAGTGCAGTACCTATCTCAGCCACAGCCACAGCCCTATGCTGTGCATG
GCCACTTTCAGCCCACTCAGACAGGTTTCCTCCAGCCTGGTGGTGCCCTGTCCTTGCAAAAGCAGATGGA
ACATGCTAACCAGCAGACTGGCTTCTCCGACTCATCCTCTCTGCGCCCCATGCACCCCCAGGCTCTGCAT
CCAGCCCCTGGACTCCTTGCTTCCCCCCAGCTCCCTGTGCAGATGCAGCCAGCAGGAAAGTCGGGCTTTG
CAGCTACCAGCCAACCTGGCCCTCGGCTCCCCTTCATCCAACACAGCCAGAACCCGCGATTCTACCACAA
G

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC210464 protein sequence
Red=Cloning site Green=Tags(s)

MPALLERPKLSNAMARALHRHIMMERERKRQEEEEVDKMMEQKMKEEQERRKKKEMEERMSLEETKEQIL
KLEEKLLALQEEKHQLFLQLKKVLHEEEKRRRKEQSDLTTLTSAAYQQSLTVHTGTHLLSMQGSPGGHNR
PGTLMAADRAKQMFGPQVLTTRHYVGSAAAFAGTPEHGQFQGSPGGAYGTAQPPPHYGPTQPAYSPSQQL
RAPSAFPAVQYLSQPQPQPYAVHGHFQPTQTGFLQPGGALSLQKQMEHANQQTGFSDSSSLRPMHPQALH
PAPGLLASPQLPVQMQPAGKSGFAATSQPGPRLPFIQHSQNPRFYHK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_004489
ORF Size 981 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004489.5
RefSeq Size 1181 bp
RefSeq ORF 984 bp
Locus ID 2874
UniProt ID Q13227
Cytogenetics 17p13.1
Domains NEUZ
Protein Families Druggable Genome
MW 36.7 kDa
Summary This gene encodes a protein involved in G protein-mitogen-activated protein kinase (MAPK) signaling cascades. When overexpressed in mammalian cells, this gene could potently suppress a RAS- and MAPK-mediated signal and interfere with JNK activity, suggesting that the function of this gene may be signal repression. The encoded protein is an integral subunit of the NCOR1-HDAC3 (nuclear receptor corepressor 1-histone deacetylase 3) complex, and it was shown that the complex inhibits JNK activation through this subunit and thus could potentially provide an alternative mechanism for hormone-mediated antagonism of AP1 (activator protein 1) function. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_004489" in other vectors (6)
SKU Description Size Price
RC210464L1 Lenti ORF clone of Human G protein pathway suppressor 2 (GPS2), Myc-DDK-tagged 10 ug
$600.00
RC210464L2 Lenti ORF clone of Human G protein pathway suppressor 2 (GPS2), mGFP tagged 10 ug
$600.00
RC210464L3 Lenti ORF clone of Human G protein pathway suppressor 2 (GPS2), Myc-DDK-tagged 10 ug
$600.00
RC210464L4 Lenti ORF clone of Human G protein pathway suppressor 2 (GPS2), mGFP tagged 10 ug
$600.00
RG210464 GPS2 (tGFP-tagged) - Human G protein pathway suppressor 2 (GPS2) 10 ug
$489.00 $500.00
SC109278 GPS2 (untagged)-Human G protein pathway suppressor 2 (GPS2) 10 ug
$300.00

Plasmid Map for RC210464

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC210464
Circular map for RC210464

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products