OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SMARCE1 (NM_003079) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC209444
SMARCE1 (Myc-DDK-tagged)-Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
  $686.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA381767 BAF57/SMARCE1 Rabbit polyclonal Antibody
100 ul
$475.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SMARCE1 or NM_003079"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SMARCE1
Synonyms BAF57; CSS5
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC209444 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAAAAAGACCATCTTATGCCCCACCTCCCACCCCAGCTCCTGCAACACAAATGCCCAGCACACCAG
GGTTTGTGGGATACAATCCATACAGTCATCTCGCCTACAACAACTACAGGCTGGGAGGGAACCCGGGCAC
CAACAGCCGGGTCACGGCATCCTCTGGTATCACGATTCCAAAACCCCCAAAGCCACCAGATAAGCCGCTG
ATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGACCAAGTAAAGGCTTCCAACCCTGACCTAAAGTTGT
GGGAGATTGGCAAGATTATTGGTGGCATGTGGCGAGATCTCACTGATGAAGAAAAACAAGAATATTTAAA
CGAATACGAAGCAGAAAAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCGCGTACCTT
GCTTACATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCGACAGAGACAATCTCGCA
TGGAGAAAGGAGAACCGTACATGAGCATTCAGCCTGCTGAAGATCCAGATGATTATGATGATGGCTTTTC
AATGAAGCATACAGCCACCGCCCGTTTCCAGAGAAACCACCGCCTCATCAGTGAAATTCTTAGTGAGAGT
GTGGTGCCAGACGTTCGGTCAGTTGTCACAACAGCTAGAATGCAGGTCCTCAAACGGCAGGTCCAGTCCT
TAATGGTTCATCAGCGAAAACTAGAAGCTGAACTTCTTCAAATAGAGGAACGACACCAGGAGAAGAAGAG
GAAATTCCTGGAAAGCACAGATTCATTTAACAATGAACTTAAAAGGTTGTGCGGTCTGAAAGTAGAAGTG
GATATGGAGAAAATTGCAGCTGAGATTGCACAGGCAGAGGAACAGGCCCGCAAAAGGCAGGAGGAAAGGG
AGAAGGAGGCCGCAGAGCAAGCTGAGCGCAGTCAGAGCAGCATCGTTCCTGAGGAAGAACAAGCAGCTAA
CAAAGGCGAGGAGAAGAAAGACGACGAGAACATTCCGATGGAGACAGAGGAGACACACCTTGAAGAAACA
ACAGAGAGCCAACAGAATGGTGAAGAAGGCACGTCTACTCCTGAGGACAAGGAGAGTGGGCAGGAGGGGG
TCGACAGTATGGCAGAGGAAGGAACCAGTGATAGTAACACTGGCTCGGAGAGCAACAGTGCAACAGTGGA
GGAGCCACCAACAGATCCCATACCAGAAGATGAGAAAAAAGAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC209444 protein sequence
Red=Cloning site Green=Tags(s)

MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIPKPPKPPDKPL
MPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYL
AYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQRNHRLISEILSES
VVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEV
DMEKIAAEIAQAEEQARKRQEEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEET
TESQQNGEEGTSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003079
ORF Size 1233 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003079.5
RefSeq Size 2425 bp
RefSeq ORF 1236 bp
Locus ID 6605
UniProt ID Q969G3, A0A024R1S7
Cytogenetics 17q21.2
Domains HMG
Protein Families Transcription Factors
MW 46.6 kDa
Summary The protein encoded by this gene is part of the large ATP-dependent chromatin remodeling complex SWI/SNF, which is required for transcriptional activation of genes normally repressed by chromatin. The encoded protein, either alone or when in the SWI/SNF complex, can bind to 4-way junction DNA, which is thought to mimic the topology of DNA as it enters or exits the nucleosome. The protein contains a DNA-binding HMG domain, but disruption of this domain does not abolish the DNA-binding or nucleosome-displacement activities of the SWI/SNF complex. Unlike most of the SWI/SNF complex proteins, this protein has no yeast counterpart. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003079" in other vectors (6)
SKU Description Size Price
RC209444L1 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), Myc-DDK-tagged 10 ug
$986.00
RC209444L2 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), mGFP tagged 10 ug
$986.00
RC209444L3 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), Myc-DDK-tagged 10 ug
$986.00
RC209444L4 Lenti ORF clone of Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1), mGFP tagged 10 ug
$986.00
RG209444 SMARCE1 (tGFP-tagged) - Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1) 10 ug
$489.00 $886.00
SC118214 SMARCE1 (untagged)-Human SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 (SMARCE1) 10 ug
$686.00

Plasmid Map for RC209444

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC209444
Circular map for RC209444

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products