OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CSP (DNAJC5) (NM_025219) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208826
DNAJC5 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA311460 Goat Anti-Dnajc5 (aa177-191) Antibody
100 ug
$565.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CSP or NM_025219"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSP
Synonyms CLN4; CLN4B; CSP; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208826 representing NM_025219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGACCAGAGACAGCGCTCACTGTCTACCTCTGGGGAGTCATTGTACCACGTCCTTGGGTTGGACA
AGAACGCAACCTCAGATGACATTAAAAAGTCCTATCGGAAGCTTGCCTTGAAATATCACCCCGACAAGAA
CCCCGACAACCCGGAGGCCGCGGACAAGTTTAAGGAGATCAACAACGCGCACGCCATCCTCACGGACGCC
ACAAAAAGGAACATCTACGACAAGTACGGCTCGCTGGGTCTCTACGTGGCCGAGCAGTTTGGGGAAGAGA
ACGTGAACACCTACTTCGTGCTGTCCAGCTGGTGGGCCAAGGCCCTGTTTGTCTTCTGCGGCCTCCTCAC
GTGCTGCTACTGCTGCTGCTGTCTGTGCTGCTGCTTCAACTGCTGCTGCGGGAAGTGTAAGCCCAAGGCG
CCTGAAGGCGAGGAGACGGAGTTCTACGTGTCCCCCGAGGATCTGGAGGCACAGCTGCAGTCTGACGAGA
GGGAGGCCACAGACACGCCGATCGTCATACAGCCGGCATCCGCCACCGAGACCACCCAGCTCACAGCCGA
CTCCCACCCCAGCTACCACACTGACGGGTTCAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208826 representing NM_025219
Red=Cloning site Green=Tags(s)

MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA
TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA
PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_025219
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025219.2
RefSeq Size 3286 bp
RefSeq ORF 597 bp
Locus ID 80331
UniProt ID Q9H3Z4
Cytogenetics 20q13.33
Protein Families Transmembrane
MW 22 kDa
Summary This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. provided by RefSeq, Nov 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_025219" in other vectors (6)
SKU Description Size Price
RC208826L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), Myc-DDK-tagged 10 ug
$600.00
RC208826L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mGFP tagged 10 ug
$600.00
RC208826L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), Myc-DDK-tagged 10 ug
$600.00
RC208826L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mGFP tagged 10 ug
$600.00
RG208826 DNAJC5 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) 10 ug
$500.00
SC305246 DNAJC5 (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) 10 ug
$300.00

Plasmid Map for RC208826

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208826
Circular map for RC208826

file-alt Citations

Unconventional secretion of α-synuclein mediated by palmitoylated DNAJC5 oligomers
Wu, Hernandez Villegas, Sirkis et al
Elife (2023) 12 DOI: 10.7554/eLife.85837
AI Summary: In this study, OriGene products SNCA (Myc-DDK-tagged)-Human synuclein, alpha (Cat# RC221446) and CSP (DNAJC5) (NM_025219) Human Tagged ORF Clone (Cat# RC208826) were used to express α-synuclein and DNAJC5 in cells, enabling the investigation of DNAJC5-mediated unconventional secretion of α-synuclein.
Snippet: mCherry-Rab5CA (Q79L) Addgene Cat# 35138 Recombinant DNA reagent BFP-Rab5CA (Q79L) This study N/A Recombinant DNA reagent SNCA (Myc-DDK-tagged)-Human synuclein, alpha OriGene Technoogy Cat# RC221446 Recombinant DNA reagent CSP (DNAJC5) (NM_025219) Human Tagged ORF Clone OriGene Technology Cat# RC208826 Recombinant DNA reagent TCH1003-MGC prem;Recombinant DNA reagent BFP-Rab5CA (Q79L) This study N/A Recombinant DNA reagent SNCA (Myc-DDK-tagged)-Human synuclein, alpha OriGene Technoogy Cat# RC221446 Recombinant DNA reagent CSP (DNAJC5) (NM_025219) Human Tagged ORF Clone OriGene Technology Cat# RC208826
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products