CSP (DNAJC5) (NM_025219) Human Tagged ORF Clone

SKU
RG208826
DNAJC5 (tGFP-tagged) - Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5)
  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

$500.00
3 Weeks*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CSP
Synonyms CLN4; CLN4B; CSP; DNAJC5A; mir-941-2; mir-941-3; mir-941-4; mir-941-5; NCL
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RG208826 representing NM_025219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGACCAGAGACAGCGCTCACTGTCTACCTCTGGGGAGTCATTGTACCACGTCCTTGGGTTGGACA
AGAACGCAACCTCAGATGACATTAAAAAGTCCTATCGGAAGCTTGCCTTGAAATATCACCCCGACAAGAA
CCCCGACAACCCGGAGGCCGCGGACAAGTTTAAGGAGATCAACAACGCGCACGCCATCCTCACGGACGCC
ACAAAAAGGAACATCTACGACAAGTACGGCTCGCTGGGTCTCTACGTGGCCGAGCAGTTTGGGGAAGAGA
ACGTGAACACCTACTTCGTGCTGTCCAGCTGGTGGGCCAAGGCCCTGTTTGTCTTCTGCGGCCTCCTCAC
GTGCTGCTACTGCTGCTGCTGTCTGTGCTGCTGCTTCAACTGCTGCTGCGGGAAGTGTAAGCCCAAGGCG
CCTGAAGGCGAGGAGACGGAGTTCTACGTGTCCCCCGAGGATCTGGAGGCACAGCTGCAGTCTGACGAGA
GGGAGGCCACAGACACGCCGATCGTCATACAGCCGGCATCCGCCACCGAGACCACCCAGCTCACAGCCGA
CTCCCACCCCAGCTACCACACTGACGGGTTCAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
Protein Sequence
>RG208826 representing NM_025219
Red=Cloning site Green=Tags(s)

MADQRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDA
TKRNIYDKYGSLGLYVAEQFGEENVNTYFVLSSWWAKALFVFCGLLTCCYCCCCLCCCFNCCCGKCKPKA
PEGEETEFYVSPEDLEAQLQSDEREATDTPIVIQPASATETTQLTADSHPSYHTDGFN

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_025219
ORF Size 594 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_025219.2
RefSeq Size 3286 bp
RefSeq ORF 597 bp
Locus ID 80331
UniProt ID Q9H3Z4
Cytogenetics 20q13.33
Protein Families Transmembrane
Summary This gene is a member of the J protein family. J proteins function in many cellular processes by regulating the ATPase activity of 70 kDa heat shock proteins. The encoded protein plays a role in membrane trafficking and protein folding, and has been shown to have anti-neurodegenerative properties. The encoded protein is known to play a role in cystic fibrosis and Huntington's disease. A pseudogene of this gene is located on the short arm of chromosome 8. [provided by RefSeq, Nov 2010]
Write Your Own Review
You're reviewing:CSP (DNAJC5) (NM_025219) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC208826 DNAJC5 (Myc-DDK-tagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) 10 ug
$300.00
RC208826L1 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), Myc-DDK-tagged 10 ug
$600.00
RC208826L2 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mGFP tagged 10 ug
$600.00
RC208826L3 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), Myc-DDK-tagged 10 ug
$600.00
RC208826L4 Lenti ORF clone of Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5), mGFP tagged 10 ug
$600.00
SC305246 DNAJC5 (untagged)-Human DnaJ (Hsp40) homolog, subfamily C, member 5 (DNAJC5) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.