BCL10 (NM_003921) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC208752
BCL10 (Myc-DDK-tagged)-Human B-cell CLL/lymphoma 10 (BCL10)
$450.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BCL10
Synonyms c-E10; CARMEN; CIPER; CLAP; IMD37; mE10
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208752 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCCCACCGCACCGTCCCTCACCGAGGAGGACCTCACTGAAGTGAAGAAGGACGCCTTAGAAAATT
TACGTGTATACCTGTGTGAGAAAATCATAGCTGAGAGACATTTTGATCATCTACGTGCAAAAAAAATACT
CAGTAGAGAAGACACTGAAGAAATTTCTTGTCGAACATCAAGTAGAAAAAGGGCTGGAAAATTGTTAGAC
TACTTACAGGAAAACCCAAAAGGTCTGGACACCCTTGTTGAATCTATTCGGCGAGAAAAAACACAGAACT
TCCTGATACAGAAGATTACAGATGAAGTGCTGAAACTTAGAAATATAAAACTAGAACATCTGAAAGGACT
AAAATGTAGCAGTTGTGAACCTTTTCCAGATGGAGCCACGAACAACCTCTCCAGATCAAATTCAGATGAG
AGTAATTTCTCTGAAAAACTGAGGGCATCCACTGTCATGTACCATCCAGAAGGAGAATCCAGCACGACGC
CCTTTTTTTCTACTAATTCTTCTCTGAATTTGCCTGTTCTAGAAGTAGGCAGAACTGAAAATACCATCTT
CTCTTCAACTACACTTCCCAGACCTGGGGACCCAGGGGCTCCTCCTTTGCCACCAGATCTACAGTTAGAA
GAAGAAGGAACTTGTGCAAACTCTAGTGAGATGTTTCTTCCCTTAAGATCACGTACTGTTTCACGACAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC208752 protein sequence
Red=Cloning site Green=Tags(s)

MEPTAPSLTEEDLTEVKKDALENLRVYLCEKIIAERHFDHLRAKKILSREDTEEISCRTSSRKRAGKLLD
YLQENPKGLDTLVESIRREKTQNFLIQKITDEVLKLRNIKLEHLKGLKCSSCEPFPDGATNNLSRSNSDE
SNFSEKLRASTVMYHPEGESSTTPFFSTNSSLNLPVLEVGRTENTIFSSTTLPRPGDPGAPPLPPDLQLE
EEGTCANSSEMFLPLRSRTVSRQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_003921
ORF Size 699 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003921.5
RefSeq Size 3118 bp
RefSeq ORF 702 bp
Locus ID 8915
UniProt ID O95999
Cytogenetics 1p22.3
Domains CARD
Protein Families Druggable Genome
Protein Pathways B cell receptor signaling pathway, T cell receptor signaling pathway
MW 26.3 kDa
Summary This gene was identified by its translocation in a case of mucosa-associated lymphoid tissue (MALT) lymphoma. The protein encoded by this gene contains a caspase recruitment domain (CARD), and has been shown to induce apoptosis and to activate NF-kappaB. This protein is reported to interact with other CARD domain containing proteins including CARD9, 10, 11 and 14, which are thought to function as upstream regulators in NF-kappaB signaling. This protein is found to form a complex with MALT1, a protein encoded by another gene known to be translocated in MALT lymphoma. MALT1 and this protein are thought to synergize in the activation of NF-kappaB, and the deregulation of either of them may contribute to the same pathogenetic process that leads to the malignancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
RC208752L1 Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), Myc-DDK-tagged 10 ug
$750.00
RC208752L2 Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), mGFP tagged 10 ug
$750.00
RC208752L3 Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), Myc-DDK-tagged 10 ug
$750.00
RC208752L4 Lenti ORF clone of Human B-cell CLL/lymphoma 10 (BCL10), mGFP tagged 10 ug
$750.00
RG208752 BCL10 (tGFP-tagged) - Human B-cell CLL/lymphoma 10 (BCL10) 10 ug
$650.00
SC117685 BCL10 (untagged)-Human B-cell CLL/lymphoma 10 (BCL10) 10 ug
$450.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.