OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

EXOSC6 (NM_058219) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208634
EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA343971 Rabbit Polyclonal Anti-EXOSC6 Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "EXOSC6 or NM_058219"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EXOSC6
Synonyms EAP4; hMtr3p; MTR3; Mtr3p; p11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208634 representing NM_058219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGGGATCACCGCCGCATCCGCGGCCCTGAAGAATCGCAGCCGCCGCAGCTGTACGCGGCCGACG
AGGAGGAGGCGCCCGGCACCCGCGACCCAACGCGGCTACGGCCCGTGTACGCGCGCGCCGGGCTGCTGAG
CCAGGCCAAGGGCTCGGCCTACCTGGAGGCGGGAGGCACCAAGGTGCTGTGTGCCGTGTCGGGCCCGCGA
CAGGCCGAGGGCGGCGAGCGCGGCGGCGGCCCGGCCGGAGCAGGCGGCGAGGCCCCGGCCGCGCTGCGCG
GTCGCCTGCTCTGCGACTTCCGCCGCGCACCCTTCGCGGGCCGCCGGCGCCGCGCTCCCCCGGGCGGCTG
CGAGGAGCGTGAGCTGGCGCTGGCGCTGCAGGAGGCGCTGGAGCCGGCTGTGCGCCTGGGCCGCTACCCG
CGCGCGCAGCTCGAGGTGTCGGCGCTGCTGCTGGAGGACGGTGGCTCGGCCCTGGCCGCCGCGCTCACCG
CCGCCGCGCTCGCCCTGGCCGACGCGGGCGTGGAGATGTACGACCTGGTGGTGGGCTGCGGCCTCAGCCT
CGCGCCGGGGCCCGCGCCCACCTGGCTCCTGGACCCCACGCGGCTCGAGGAAGAGCGCGCCGCCGCCGGC
CTCACCGTGGCGCTCATGCCTGTGCTGAATCAGGTGGCCGGGCTGCTGGGCAGCGGCGAGGGCGGCCTGA
CAGAGAGCTGGGCGGAGGCCGTACGCCTGGGCCTCGAGGGCTGCCAGCGCCTCTACCCCGTGCTGCAGCA
GAGCCTGGTGCGGGCCGCCCGCCGCAGGGGCGCCGCCGCCCAGCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208634 representing NM_058219
Red=Cloning site Green=Tags(s)

MPGDHRRIRGPEESQPPQLYAADEEEAPGTRDPTRLRPVYARAGLLSQAKGSAYLEAGGTKVLCAVSGPR
QAEGGERGGGPAGAGGEAPAALRGRLLCDFRRAPFAGRRRRAPPGGCEERELALALQEALEPAVRLGRYP
RAQLEVSALLLEDGGSALAAALTAAALALADAGVEMYDLVVGCGLSLAPGPAPTWLLDPTRLEEERAAAG
LTVALMPVLNQVAGLLGSGEGGLTESWAEAVRLGLEGCQRLYPVLQQSLVRAARRRGAAAQP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_058219
ORF Size 816 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_058219.3
RefSeq Size 1729 bp
RefSeq ORF 819 bp
Locus ID 118460
UniProt ID Q5RKV6
Cytogenetics 16q22.1
Domains RNase_PH_C
Protein Pathways RNA degradation
MW 28.2 kDa
Summary This gene product constitutes one of the subunits of the multisubunit particle called exosome, which mediates mRNA degradation. The composition of human exosome is similar to its yeast counterpart. This protein is homologous to the yeast Mtr3 protein. Its exact function is not known, however, it has been shown using a cell-free RNA decay system that the exosome is required for rapid degradation of unstable mRNAs containing AU-rich elements (AREs), but not for poly(A) shortening. The exosome does not recognize ARE-containing mRNAs on its own, but requires ARE-binding proteins that could interact with the exosome and recruit it to unstable mRNAs, thereby promoting their rapid degradation. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_058219" in other vectors (7)
SKU Description Size Price
RC208634L1 Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6) 10 ug
$600.00
RC208634L2 Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6) 10 ug
$600.00
RC208634L3 Lenti-ORF clone of EXOSC6 (Myc-DDK-tagged)-Human exosome component 6 (EXOSC6) 10 ug
$600.00
RC208634L4 Lenti-ORF clone of EXOSC6 (mGFP-tagged)-Human exosome component 6 (EXOSC6) 10 ug
$600.00
RG208634 EXOSC6 (tGFP-tagged) - Human exosome component 6 (EXOSC6) 10 ug
$500.00
SC120246 EXOSC6 (untagged)-Human exosome component 6 (EXOSC6) 10 ug
$300.00
SC320513 EXOSC6 (untagged)-Human exosome component 6 (EXOSC6) 10 ug
$300.00

Plasmid Map for RC208634

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208634
Circular map for RC208634

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products