OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CCDC103 (NM_213607) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC208345
CCDC103 (Myc-DDK-tagged)-Human coiled-coil domain containing 103 (CCDC103)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA334889 Rabbit Polyclonal Anti-CCDC103 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CCDC103 or NM_213607"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CCDC103
Synonyms CILD17; PR46b; SMH
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC208345 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAGGAATGACATCATCAACTTCAAGGCTTTGGAGAAAGAGCTGCAGGCTGCACTCACTGCTGATG
AGAAGTACAAACGGGAGAATGCTGCCAAGTTACGGGCAGTGGAACAGAGGGTGGCTTCCTATGAGGAGTT
CAGGGGTATTGTCCTTGCATCACATCTGAAGCCACTGGAGCGGAAGGATAAGATGGGAGGAAAGAGAACT
GTGCCCTGGAACTGTCACACTATTCAGGGAAGGACCTTCCAGGATGTGGCCACTGAAATCTCCCCGGAGA
AAGCCCCCCTCCAGCCCGAGACGTCTGCTGACTTCTATCGTGATTGGCGACGACACTTGCCAAGTGGGCC
AGAGCGCTACCAGGCTCTACTGCAGCTTGGGGGTCCAAGGCTCGGCTGCCTCTTCCAGACAGATGTGGGA
TTTGGACTTCTTGGGGAGCTGCTGGTGGCACTGGCTGATCACGTGGGGCCGGCTGACCGGGCAGCGGTGC
TGGGGATCCTATGCAGCCTGGCGAGCACTGGGCGCTTCACCCTGAACCTAAGCCTGCTGAGCCGGGCAGA
GAGAGAGAGCTGCAAGGGCTTGTTTCAGAAGCTGCAAGCCATGGGCAACCCCAGATCCGTGAAGGAGGGG
CTCAGCTGGGAGGAGCAGGGTCTGGAGGAGCAGTCTGGTGGGCTCCAGGAGGAGGAGAGGCTCCTGCAGG
AGCTGCTGGAGCTGTACCAGGTTGAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC208345 protein sequence
Red=Cloning site Green=Tags(s)

MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLERKDKMGGKRT
VPWNCHTIQGRTFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERYQALLQLGGPRLGCLFQTDVG
FGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNLSLLSRAERESCKGLFQKLQAMGNPRSVKEG
LSWEEQGLEEQSGGLQEEERLLQELLELYQVD

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_213607
ORF Size 726 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_213607.3
RefSeq Size 1766 bp
RefSeq ORF 729 bp
Locus ID 388389
UniProt ID Q8IW40
Cytogenetics 17q21.31
MW 27.2 kDa
Summary This gene encodes a protein that contains a coiled-coil domain. provided by RefSeq, Apr 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_213607" in other vectors (6)
SKU Description Size Price
RC208345L1 Lenti ORF clone of Human coiled-coil domain containing 103 (CCDC103), Myc-DDK-tagged 10 ug
$600.00
RC208345L2 Lenti ORF clone of Human coiled-coil domain containing 103 (CCDC103), mGFP tagged 10 ug
$600.00
RC208345L3 Lenti ORF clone of Human coiled-coil domain containing 103 (CCDC103), Myc-DDK-tagged 10 ug
$600.00
RC208345L4 Lenti ORF clone of Human coiled-coil domain containing 103 (CCDC103), mGFP tagged 10 ug
$600.00
RG208345 CCDC103 (tGFP-tagged) - Human coiled-coil domain containing 103 (CCDC103) 10 ug
$489.00 $500.00
SC319947 CCDC103 (untagged)-Human coiled-coil domain containing 103 (CCDC103) 10 ug
$300.00

Plasmid Map for RC208345

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC208345
Circular map for RC208345

file-alt Citations

DYX1C1 is required for axonemal dynein assembly and ciliary motility
Tarkar, Loges, Slagle et al
Nat. Genet. (2013) 45 (9), 995-1003 DOI: 10.1038/ng.2707
Cited by 292
AI Summary: In this study, OriGene products, including the DYX1C1 cDNA clone and anti-DYX1C1 antibody, were used to analyze DYX1C1 expression and function, helping to demonstrate its essential role in axonemal dynein assembly and ciliary motility.
Snippet: Heymut Omran, Joseph LoTurco and colleagues show that mutations in the dyslexia susceptibility candidate gene DYX1C1 cause primary ciliary dyskinesia. Their functional studies suggest that DYX1C1 is required for the cytoplasmic preassembly of axonemal dynein complexes
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products