OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DOLPP1 (NM_020438) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207638
DOLPP1 (Myc-DDK-tagged)-Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA338419 Rabbit Polyclonal Anti-DOLPP1 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DOLPP1 or NM_020438"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DOLPP1
Synonyms LSFR2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207638 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCAGCGGACGGACAGTGCTCGCTCCCCGCTTCATGGCGGCCGGTGACCCTCACCCACGTCGAATATC
CTGCAGGTGATCTCTCTGGCCACCTCCTTGCCTACCTGAGCCTCAGCCCTGTATTTGTCATCGTCGGTTT
CGTGACCCTCATCATATTTAAGCGGGAGCTGCACACGATCTCCTTCCTTGGGGGCCTGGCACTGAACGAG
GGGGTCAACTGGCTGATCAAAAACGTCATCCAGGAGCCACGGCCCTGTGGAGGCCCCCACACAGCAGTGG
GCACCAAGTACGGGATGCCCTCCAGCCATTCCCAGTTTATGTGGTTCTTCTCCGTCTATTCCTTCCTTTT
CCTGTATTTAAGAATGCACCAAACAAACAACGCCAGGTTCCTGGACTTGCTGTGGAGGCACGTGCTCTCC
CTGGGACTCCTCGCTGTGGCCTTCCTAGTCTCCTACAGCAGGGTCTACCTGCTGTACCACACCTGGAGCC
AGGTGCTCTATGGAGGCATCGCTGGAGGCCTCATGGCCATCGCCTGGTTCATCTTCACCCAGGAGGTCCT
CACCCCGCTGTTCCCCAGGATAGCAGCCTGGCCTGTCTCCGAGTTCTTCCTAATCCGAGACACAAGCCTC
ATTCCCAACGTACTCTGGTTTGAGTACACGGTAACCCGGGCAGAAGCCAGGAACAGACAACGCAAGCTGG
GGACGAAACTGCAG

AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207638 protein sequence
Red=Cloning site Green=Tags(s)

MAADGQCSLPASWRPVTLTHVEYPAGDLSGHLLAYLSLSPVFVIVGFVTLIIFKRELHTISFLGGLALNE
GVNWLIKNVIQEPRPCGGPHTAVGTKYGMPSSHSQFMWFFSVYSFLFLYLRMHQTNNARFLDLLWRHVLS
LGLLAVAFLVSYSRVYLLYHTWSQVLYGGIAGGLMAIAWFIFTQEVLTPLFPRIAAWPVSEFFLIRDTSL
IPNVLWFEYTVTRAEARNRQRKLGTKLQ

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene | Plasmid Map
ACCN NM_020438
ORF Size 714 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020438.5
RefSeq Size 2225 bp
RefSeq ORF 717 bp
Locus ID 57171
UniProt ID Q86YN1, A0A024R8B5
Cytogenetics 9q34.11
Protein Families Druggable Genome, Transmembrane
Protein Pathways N-Glycan biosynthesis
MW 27 kDa
Summary A similar gene has been characterized in mice and encodes dolichyl pyrophosphate (Dol-P-P) phosphatase. This protein dephosphorylates dolichyl pyrophosphate so that it may be re-utilized as a glycosyl carrier lipid by the oligosaccharyltransferase multisubunit complex in the ER. Alternative splicing results in multiple transcript variants and protein isoforms. provided by RefSeq, Jun 2012
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_020438" in other vectors (7)
SKU Description Size Price
RC207638L1 Lenti ORF clone of Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207638L2 Lenti ORF clone of Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RC207638L3 Lenti ORF clone of Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC207638L4 Lenti ORF clone of Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1, mGFP tagged 10 ug
$600.00
RG207638 DOLPP1 (tGFP-tagged) - Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1 10 ug
$489.00 $500.00
SC107051 DOLPP1 (untagged)-Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1 10 ug
$300.00
SC321999 DOLPP1 (untagged)-Human dolichyl pyrophosphate phosphatase 1 (DOLPP1), transcript variant 1 10 ug
$300.00

Plasmid Map for RC207638

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207638
Circular map for RC207638

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products