SEM1 (NM_006304) Human Tagged ORF Clone

  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

SKU
RC207564
SHFM1 (Myc-DDK-tagged)-Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1)
$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SEM1
Synonyms C7orf76; DSS1; ECD; PSMD15; SHFD1; Shfdg1; SHFM1; SHSF1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207564 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGAGAAAAAGCAGCCGGTAGACTTAGGTCTGTTAGAGGAAGACGACGAGTTTGAAGAGTTCCCTG
CCGAAGACTGGGCTGGCTTAGATGAAGATGAAGATGCACATGTCTGGGAGGATAATTGGGATGATGACAA
TGTAGAGGATGACTTCTCTAATCAGTTACGAGCTGAACTAGAGAAACATGGTTATAAGATGGAGACTTCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207564 protein sequence
Red=Cloning site Green=Tags(s)

MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVEDDFSNQLRAELEKHGYKMETS

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_006304
ORF Size 210 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006304.1, NP_006295.1
RefSeq Size 509 bp
RefSeq ORF 213 bp
Locus ID 7979
UniProt ID P60896
Cytogenetics 7q21.3
Domains DSS1_SEM1
Protein Pathways Homologous recombination, Proteasome
MW 8.3 kDa
Summary The product of this gene has been localized within the split hand/split foot malformation locus SHFM1 at chromosome 7. It has been proposed to be a candidate gene for the autosomal dominant form of the heterogeneous limb developmental disorder split hand/split foot malformation type 1. In addition, it has been shown to directly interact with BRCA2. It also may play a role in the completion of the cell cycle. [provided by RefSeq, Jul 2008]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
RC207564L1 Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), Myc-DDK-tagged 10 ug
$450.00
RC207564L2 Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), mGFP tagged 10 ug
$450.00
RC207564L3 Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), Myc-DDK-tagged 10 ug
$450.00
RC207564L4 Lenti ORF clone of Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1), mGFP tagged 10 ug
$450.00
RG207564 SHFM1 (tGFP-tagged) - Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1) 10 ug
$489.00
SC111062 SHFM1 (untagged)-Human split hand/foot malformation (ectrodactyly) type 1 (SHFM1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.