OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DEXI (NM_014015) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207463
DEXI (Myc-DDK-tagged)-Human Dexi homolog (mouse) (DEXI)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA375426 DEXI Rabbit polyclonal Antibody
100 ul
$410.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DEXI or NM_014015"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DEXI
Synonyms MYLE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207463 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCGGCGCCCGGGTCGCGGCCCACCTGGACGCACTGGGCCCCCTGGTCCCCTACGTGCCGCCGCCGC
TGCTGCCCTCTATGTTCTACGTGGGCCTGTTCTTCGTCAATGTGCTGATCCTGTACTACGCCTTCCTCAT
GGAGTACATCGTCCTCAACGTGGGCCTCGTCTTCCTGCCCGAGGACATGGACCAGGCGCTCGTGGACCTC
GGCGTGCTCTCCGACCCCGGCTCGGGCCTTTACGATGCTGACTCGGAGCTCGACGTCTTTGATGCGTACT
TGGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207463 protein sequence
Red=Cloning site Green=Tags(s)

MLGARVAAHLDALGPLVPYVPPPLLPSMFYVGLFFVNVLILYYAFLMEYIVLNVGLVFLPEDMDQALVDL
GVLSDPGSGLYDADSELDVFDAYLE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014015
ORF Size 285 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014015.4
RefSeq Size 1580 bp
RefSeq ORF 288 bp
Locus ID 28955
UniProt ID O95424
Cytogenetics 16p13.13
Protein Families Transmembrane
MW 10.4 kDa
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014015" in other vectors (6)
SKU Description Size Price
RC207463L1 Lenti ORF clone of Human Dexi homolog (mouse) (DEXI), Myc-DDK-tagged 10 ug
$450.00
RC207463L2 Lenti ORF clone of Human Dexi homolog (mouse) (DEXI), mGFP tagged 10 ug
$450.00
RC207463L3 Lenti ORF clone of Human Dexi homolog (mouse) (DEXI), Myc-DDK-tagged 10 ug
$450.00
RC207463L4 Lenti ORF clone of Human Dexi homolog (mouse) (DEXI), mGFP tagged 10 ug
$450.00
RG207463 DEXI (tGFP-tagged) - Human Dexi homolog (mouse) (DEXI) 10 ug
$489.00
SC115174 DEXI (untagged)-Human Dexi homolog (mouse) (DEXI) 10 ug
$150.00

Plasmid Map for RC207463

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207463
Circular map for RC207463

file-alt Citations

Is DEXI a Multiple Sclerosis Susceptibility Gene?
Eriksson, Emini, Harbo et al
Int J Mol Sci (2025) 26 (3) DOI: 10.3390/ijms26031175
AI Summary: In this study, OriGene's Myc-DDK-DEXI plasmid (RC207463) was used to overexpress DEXI in Jurkat T cells, enabling the analysis of DEXI protein localization and expression by Western blotting to investigate its potential role in multiple sclerosis susceptibility.
Snippet: E-PER Nuclear and Cytoplasmic Extraction Kit (Thermo Fisher Scientific, Madison, WI, USA) and the presence of DEXI in unstimulated and stimulated Jurkat T cells overexpressing Myc-DDK-DEXI (RC207463;Origene Technologies, Rockville, MD, USA) were analyzed by Western blotting (rabbit anti-DEXI (Thermo Fisher Scientific, Madison, WI, USA.), using antibodies against Lamin B1 (ab16048, Abcam, Cambridg
FigureFigureFigure
DEXI, a candidate gene for type 1 diabetes, modulates rat and human pancreatic beta cell inflammation via regulation of the type I IFN/STAT signalling pathway
Dos Santos, Marroqui, Velayos et al
Diabetologia (2018)
AI Summary: In this study, the OriGene pCMV-DEXI overexpression plasmid (RC207463) was used to increase DEXI expression in pancreatic beta cells, enabling the authors to investigate DEXI's role in modulating inflammation relevant to type 1 diabetes.
Snippet: To overexpress DEXI in INS-1E and EndoC-βH1 cells, we used an overexpression plasmid encoding the human DEXI gene under the control of the cytomegalovirus promoter (pCMV-DEXI) (RC207463, Origene, Rockville, MD, USA)
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products