ZNF702 (NM_024924) Human Tagged ORF Clone

  • TrueORF®
SKU
RC207462
ZNF702 (Myc-DDK-tagged)-Human zinc finger protein 702 (ZNF702)
  $289.00
In Stock*
Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ZNF702
Synonyms FLJ12985
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207462 representing NM_024924
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGAGAAAAATCTTTCCAATGTAATGAGAGTGGCAAAGCCTTTAATTGTAGCTCACTGTTAAAAAAAT
GTCAGATAATCCATTTAGGAGAGAAAAAATATAAATGTGATATATGTGGCAAGGTCTTTAATCAGAAGCG
ATACCTTGCATACCATCATAGATGTCACACTGGTGAGAAACCTTACAAGTGTAATCAGTGTGGCAAGACC
TTCAGTTACAAGTCATCCCTTGTAATTCACAAGGCAATTCATACTGGAGAGAAACCTCACAAGTGTAATG
AATGTGGCAAGGTTTTTAATCAAAAAGCATATCTTGCAAGTCATCATAGACTTCATACTGGAGAGAAACC
TTACAAATGTGAAGAATGTGACAAAGTTTTTAGTCGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC207462 representing NM_024924
Red=Cloning site Green=Tags(s)

MREKSFQCNESGKAFNCSSLLKKCQIIHLGEKKYKCDICGKVFNQKRYLAYHHRCHTGEKPYKCNQCGKT
FSYKSSLVIHKAIHTGEKPHKCNECGKVFNQKAYLASHHRLHTGEKPYKCEECDKVFSR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024924
ORF Size 387 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024924.3, NP_079200.2
RefSeq Size 2996 bp
RefSeq ORF 389 bp
Locus ID 79986
Cytogenetics 19q13.41
MW 15.5 kDa
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
"NM_024924" in other vectors (4)
SKU Description Size Price
RC207462L3 Lenti ORF clone of Human zinc finger protein 702 (ZNF702), Myc-DDK-tagged 10 ug
$450.00
RC207462L4 Lenti ORF clone of Human zinc finger protein 702 (ZNF702), mGFP tagged 10 ug
$450.00
RG207462 ZNF702 (tGFP-tagged) - Human zinc finger protein 702 (ZNF702) 10 ug
$350.00
SC111614 ZNF702 (untagged)-Human zinc finger protein 702 (ZNF702) 10 ug
$150.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.