OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

YY1 (NM_003403) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC207198
YY1 (Myc-DDK-tagged)-Human YY1 transcription factor (YY1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA324719 YY1 Antibody (N-term)
400 ul
$645.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "YY1 or NM_003403"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol YY1
Synonyms DELTA; GADEVS; INO80S; NF-E1; UCRBP; YIN-YANG-1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC207198 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCGGGCGACACCCTCTACATCGCCACGGACGGCTCGGAGATGCCGGCCGAGATCGTGGAGCTGC
ACGAGATCGAGGTGGAGACCATCCCGGTGGAGACCATCGAGACCACAGTGGTGGGCGAGGAGGAGGAGGA
GGACGACGACGACGAGGACGGCGGCGGTGGCGACCACGGCGGCGGGGGCGGCCACGGGCACGCCGGCCAC
CACCACCACCACCATCACCACCACCACCACCCGCCCATGATCGCTCTGCAGCCGCTGGTCACCGACGACC
CGACCCAGGTGCACCACCACCAGGAGGTGATCCTGGTGCAGACGCGCGAGGAGGTGGTGGGCGGCGACGA
CTCGGACGGGCTGCGCGCCGAGGACGGCTTCGAGGATCAGATTCTCATCCCGGTGCCCGCGCCGGCCGGC
GGCGACGACGACTACATTGAACAAACGCTGGTCACCGTGGCGGCGGCCGGCAAGAGCGGCGGCGGCGGCT
CGTCGTCGTCGGGAGGCGGCCGCGTCAAGAAGGGCGGCGGCAAGAAGAGCGGCAAGAAGAGTTACCTCAG
CGGCGGGGCCGGCGCGGCGGGCGGCGGCGGCGCCGACCCGGGCAACAAGAAGTGGGAGCAGAAGCAGGTG
CAGATCAAGACCCTGGAGGGCGAGTTCTCGGTCACCATGTGGTCCTCAGATGAAAAAAAAGATATTGACC
ATGAGACAGTGGTTGAAGAACAGATCATTGGAGAGAACTCACCTCCTGATTATTCAGAATATATGACAGG
AAAGAAACTTCCTCCTGGAGGAATACCTGGCATTGACCTCTCAGATCCCAAACAACTGGCAGAATTTGCT
AGAATGAAGCCAAGAAAAATTAAAGAAGATGATGCTCCAAGAACAATAGCTTGCCCTCATAAAGGCTGCA
CAAAGATGTTCAGGGATAACTCGGCCATGAGAAAACATCTGCACACCCACGGTCCCAGAGTCCACGTCTG
TGCAGAATGTGGCAAAGCTTTTGTTGAGAGTTCAAAACTAAAACGACACCAACTGGTTCATACTGGAGAG
AAGCCCTTTCAGTGCACGTTCGAAGGCTGTGGGAAACGCTTTTCACTGGACTTCAATTTGCGCACACATG
TGCGAATCCATACCGGAGACAGGCCCTATGTGTGCCCCTTCGATGGTTGTAATAAGAAGTTTGCTCAGTC
AACTAACCTGAAATCTCACATCTTAACACATGCTAAGGCCAAAAACAACCAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC207198 protein sequence
Red=Cloning site Green=Tags(s)

MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHGGGGGHGHAGH
HHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDGLRAEDGFEDQILIPVPAPAG
GDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKSGKKSYLSGGAGAAGGGGADPGNKKWEQKQV
QIKTLEGEFSVTMWSSDEKKDIDHETVVEEQIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFA
RMKPRKIKEDDAPRTIACPHKGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGE
KPFQCTFEGCGKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003403
ORF Size 1242 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003403.5
RefSeq Size 3159 bp
RefSeq ORF 1245 bp
Locus ID 7528
UniProt ID P25490
Cytogenetics 14q32.2
Domains zf-C2H2
Protein Families Druggable Genome, Transcription Factors
MW 44.7 kDa
Summary YY1 is a ubiquitously distributed transcription factor belonging to the GLI-Kruppel class of zinc finger proteins. The protein is involved in repressing and activating a diverse number of promoters. YY1 may direct histone deacetylases and histone acetyltransferases to a promoter in order to activate or repress the promoter, thus implicating histone modification in the function of YY1. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003403" in other vectors (6)
SKU Description Size Price
RC207198L1 Lenti ORF clone of Human YY1 transcription factor (YY1), Myc-DDK-tagged 10 ug
$757.00
RC207198L2 Lenti ORF clone of Human YY1 transcription factor (YY1), mGFP tagged 10 ug
$757.00
RC207198L3 Lenti ORF clone of Human YY1 transcription factor (YY1), Myc-DDK-tagged 10 ug
$757.00
RC207198L4 Lenti ORF clone of Human YY1 transcription factor (YY1), mGFP tagged 10 ug
$757.00
RG207198 YY1 (tGFP-tagged) - Human YY1 transcription factor (YY1) 10 ug
$489.00 $657.00
SC118004 YY1 (untagged)-Human YY1 transcription factor (YY1) 10 ug
$457.00

Plasmid Map for RC207198

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC207198
Circular map for RC207198

file-alt Citations

YY1 directly interacts with myocardin to repress the triad myocardin/SRF/CArG box-mediated smooth muscle gene transcription during smooth muscle phenotypic modulation
Zheng, He, Liu et al
Sci Rep (2020) 10 (1), 21781 DOI: 10.1038/s41598-020-78544-3
Cited by 19
AI Summary: OriGene’s pCMV6-YY1 mammalian expression vector plasmid was used in this study to transiently overexpress YY1 in cultured cells, enabling the authors to investigate YY1’s role in repressing smooth muscle gene transcription during vascular smooth muscle cell phenotypic modulation.
Snippet: 0.5% FBS for 48 h as the differentiated condition. 10% FBS were then added to stimulate SMC phenotypic modulation for additional 48 h. Plasmids The mammalian expression vector plasmids pCMV6-YY1 (OriGene Inc.), pcDNA3.1-Myc-Myocd2 were used for transient transfection in cultured cells. Site-directed mutagenesis (Stratagene Inc.) was used to generate mutation in the YY1 binding site using YY1m,
FigureFigureFigure
Aberrant miR-1246 expression promotes radioresistance in non-small cell lung cancer: a potential prognostic biomarker and radiotherapy sensitization target
Fan, Wang, Cao et al
Am J Cancer Res (2020) 10 (1), 314-335
AI Summary: In this study, OriGene's overexpression plasmids for YY1 and CDR1as were used to investigate the regulatory roles of these genes in miR-1246-mediated radioresistance in non-small cell lung cancer.
Snippet: … Overexpressed plasmid of YY1 and CDR1as were purchased from Origene (Beijing, China);that of mTOR from Miaolingbio (Wuhan, China);- MiR-1246 agomir or antagomir with their control oligonucleotides were purchased from Ribobio (Guangzhou, China). Overexpressed plasmid of YY1 and CDR1as were purchased from Origene (Beijing, China)
Influence of TBX21 T-1993C variant on autoimmune hepatitis development by Yin-Yang 1 binding
Sun, Wu, Chen
World J. Gastroenterol. (2017) 23 (48), 8500-8511 DOI: 10.3748/wjg.v23.i48.8500
AI Summary: OriGene products contributed to this study by providing the pCMV-YY1 vector (expressing full-size YY1) and the control pCMV6-XL5 vector, which were used in cell transfection and reporter assays to investigate the functional role of YY1 binding to the TBX21 promoter.
Snippet: The pCMV-YY1 vector expressing full-size YY1 and its control pCMV6-XL5 were obtained from OriGene. Cell transfection and luciferase assay. Harvested cells were suspended in each culture medium supplemented with additional 10% fetal calf serum (FCS)
FigureFigureFigure
miR-34a inhibits the migration and invasion of esophageal squamous cell carcinoma by targeting Yin Yang-1
Nie, Ge, Geng et al
Oncol. Rep. (2015)
Cited by 60
AI Summary: OriGene contributed to this study by providing the YY1 overexpression plasmid, which was used to investigate the role of YY1 in esophageal squamous cell carcinoma cell migration and invasion.
Snippet: The protein expression was evaluated using chemiluminescence and exposure to Kodak film (Kodak, Rochester, NY, USA). YY1 overexpression plasmids and shRNA. YY1 overexpres- sion was obtained from OriGene Technologies Inc. (Rockville, MD, USA). ... Cite SaveSaving
Integrative genomics identifies YY1AP1 as an oncogenic driver in EpCAM(+) AFP(+) hepatocellular carcinoma
Zhao, Parpart, Takai et al
Oncogene (2015)
Cited by 63
AI Summary: In this study, OriGene products RC207198 (YY1 plasmid) and PS100001 (control plasmid) were used for transfection experiments to assess the functional role of YY1 in hepatocellular carcinoma cells.
Snippet: 19 ) was cotransfected or infected with a pRL-null vector containing renilla luciferase, YY1 or a control plasmid (RC207198 and PS100001, respectively, from Origene Inc., Rockville, MD, USA) and shYY1AP1-C2 or control sheGFP lentivirus. ... Related articles All 4 versions Cite SaveSaving
Showing 1-5 of 5 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products