OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Stanniocalcin 1 (STC1) (NM_003155) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC206573
STC1 (Myc-DDK-tagged)-Human stanniocalcin 1 (STC1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA810025 STC1 mouse monoclonal antibody,clone OTI6D12 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Stanniocalcin 1 or NM_003155"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Stanniocalcin 1
Synonyms STC
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206573 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTCCAAAACTCAGCAGTGCTTCTGGTGCTGGTGATCAGTGCTTCTGCAACCCATGAGGCGGAGCAGA
ATGACTCTGTGAGCCCCAGGAAATCCCGAGTGGCGGCTCAAAACTCAGCTGAAGTGGTTCGTTGCCTCAA
CAGTGCTCTACAGGTCGGCTGCGGGGCTTTTGCATGCCTGGAAAACTCCACCTGTGACACAGATGGGATG
TATGACATCTGTAAATCCTTCTTGTACAGCGCTGCTAAATTTGACACTCAGGGAAAAGCATTCGTCAAAG
AGAGCTTAAAATGCATCGCCAACGGGGTCACCTCCAAGGTCTTCCTCGCCATTCGGAGGTGCTCCACTTT
CCAAAGGATGATTGCTGAGGTGCAGGAAGAGTGCTACAGCAAGCTGAATGTGTGCAGCATCGCCAAGCGG
AACCCTGAAGCCATCACTGAGGTCGTCCAGCTGCCCAATCACTTCTCCAACAGATACTATAACAGACTTG
TCCGAAGCCTGCTGGAATGTGATGAAGACACAGTCAGCACAATCAGAGACAGCCTGATGGAGAAAATTGG
GCCTAACATGGCCAGCCTCTTCCACATCCTGCAGACAGACCACTGTGCCCAAACACACCCACGAGCTGAC
TTCAACAGGAGACGCACCAATGAGCCGCAGAAGCTGAAAGTCCTCCTCAGGAACCTCCGAGGTGAGGAGG
ACTCTCCCTCCCACATCAAACGCACATCCCATGAGAGTGCA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206573 protein sequence
Red=Cloning site Green=Tags(s)

MLQNSAVLLVLVISASATHEAEQNDSVSPRKSRVAAQNSAEVVRCLNSALQVGCGAFACLENSTCDTDGM
YDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVFLAIRRCSTFQRMIAEVQEECYSKLNVCSIAKR
NPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTIRDSLMEKIGPNMASLFHILQTDHCAQTHPRAD
FNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003155
ORF Size 741 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003155.3
RefSeq Size 3897 bp
RefSeq ORF 744 bp
Locus ID 6781
UniProt ID P52823
Cytogenetics 8p21.2
Domains Stanniocalcin
Protein Families Druggable Genome, Secreted Protein
MW 27.6 kDa
Summary This gene encodes a secreted, homodimeric glycoprotein that is expressed in a wide variety of tissues and may have autocrine or paracrine functions. The gene contains a 5' UTR rich in CAG trinucleotide repeats. The encoded protein contains 11 conserved cysteine residues and is phosphorylated by protein kinase C exclusively on its serine residues. The protein may play a role in the regulation of renal and intestinal calcium and phosphate transport, cell metabolism, or cellular calcium/phosphate homeostasis. Overexpression of human stanniocalcin 1 in mice produces high serum phosphate levels, dwarfism, and increased metabolic rate. This gene has altered expression in hepatocellular, ovarian, and breast cancers. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003155" in other vectors (7)
SKU Description Size Price
RC206573L1 Lenti ORF clone of Human stanniocalcin 1 (STC1), Myc-DDK-tagged 10 ug
$600.00
RC206573L2 Lenti ORF clone of Human stanniocalcin 1 (STC1), mGFP tagged 10 ug
$600.00
RC206573L3 Lenti ORF clone of Human stanniocalcin 1 (STC1), Myc-DDK-tagged 10 ug
$600.00
RC206573L4 Lenti ORF clone of Human stanniocalcin 1 (STC1), mGFP tagged 10 ug
$600.00
RG206573 STC1 (tGFP-tagged) - Human stanniocalcin 1 (STC1) 10 ug
$489.00 $500.00
SC111027 STC1 (untagged)-Human stanniocalcin 1 (STC1) 10 ug
$300.00
SC324585 STC1 (untagged)-Human stanniocalcin 1 (STC1) 10 ug
$300.00

Plasmid Map for RC206573

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC206573
Circular map for RC206573

file-alt Citations

Molecular and Clinical Significance of Stanniocalcin-1 Expression in Breast Cancer Through Promotion of Homologous Recombination-Mediated DNA Damage Repair
Hou, Cheng, Dai et al
Front Cell Dev Biol (2021) 9, 731086 DOI: 10.3389/fcell.2021.731086
Cited by 14
AI Summary: OriGene products, specifically the STC1 Human cDNA ORF Clone (Cat# RC206550) and STC1 shRNA plasmids (Cat# TL312045), were used in this study to modulate STC1 expression in breast cancer cell lines, enabling the authors to investigate the role of STC1 in promoting tumor growth, metastasis, DNA repair, and treatment resistance.
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products