OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

CD200 (NM_005944) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC206356
CD200 (Myc-DDK-tagged)-Human CD200 molecule (CD200), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA343314 Rabbit Polyclonal Anti-CD200 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "CD200 or NM_005944"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol CD200
Synonyms MOX1; MOX2; MRC; OX-2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC206356 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGGCTGGTGATCAGGATGCCCTTCTGTCATCTGTCTACCTACAGCCTGGTTTGGGTCATGGCAG
CAGTGGTGCTGTGCACAGCACAAGTGCAAGTGGTGACCCAGGATGAAAGAGAGCAGCTGTACACACCTGC
TTCCTTAAAATGCTCTCTGCAAAATGCCCAGGAAGCCCTCATTGTGACATGGCAGAAAAAGAAAGCTGTA
AGCCCAGAAAACATGGTCACCTTCAGCGAGAACCATGGGGTGGTGATCCAGCCTGCCTATAAGGACAAGA
TAAACATTACCCAGCTGGGACTCCAAAACTCAACCATCACCTTCTGGAATATCACCCTGGAGGATGAAGG
GTGTTACATGTGTCTCTTCAATACCTTTGGTTTTGGGAAGATCTCAGGAACGGCCTGCCTCACCGTCTAT
GTACAGCCCATAGTATCCCTTCACTACAAATTCTCTGAAGACCACCTAAATATCACTTGCTCTGCCACTG
CCCGCCCAGCCCCCATGGTCTTCTGGAAGGTCCCTCGGTCAGGGATTGAAAATAGTACAGTGACTCTGTC
TCACCCAAATGGGACCACGTCTGTTACCAGCATCCTCCATATCAAAGACCCTAAGAATCAGGTGGGGAAG
GAGGTGATCTGCCAGGTGCTGCACCTGGGGACTGTGACCGACTTTAAGCAAACCGTCAACAAAGGCTATT
GGTTTTCAGTTCCGCTATTGCTAAGCATTGTTTCCCTGGTAATTCTTCTCGTCCTAATCTCAATCTTACT
GTACTGGAAACGTCACCGGAATCAGGACCGAGAGCCC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC206356 protein sequence
Red=Cloning site Green=Tags(s)

MERLVIRMPFCHLSTYSLVWVMAAVVLCTAQVQVVTQDEREQLYTPASLKCSLQNAQEALIVTWQKKKAV
SPENMVTFSENHGVVIQPAYKDKINITQLGLQNSTITFWNITLEDEGCYMCLFNTFGFGKISGTACLTVY
VQPIVSLHYKFSEDHLNITCSATARPAPMVFWKVPRSGIENSTVTLSHPNGTTSVTSILHIKDPKNQVGK
EVICQVLHLGTVTDFKQTVNKGYWFSVPLLLSIVSLVILLVLISILLYWKRHRNQDREP

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005944
ORF Size 807 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005944.4, NP_005935.3
RefSeq Size 2226 bp
RefSeq ORF 810 bp
Locus ID 4345
UniProt ID P41217
Cytogenetics 3q13.2
Domains ig, IG, IGv
Protein Families Transmembrane
MW 30.3 kDa
Summary This gene encodes a type I membrane glycoprotein containing two extracellular immunoglobulin domains, a transmembrane and a cytoplasmic domain. This gene is expressed by various cell types, including B cells, a subset of T cells, thymocytes, endothelial cells, and neurons. The encoded protein plays an important role in immunosuppression and regulation of anti-tumor activity. Alternative splicing results in multiple transcript variants encoding different isoforms. provided by RefSeq, Jan 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005944" in other vectors (6)
SKU Description Size Price
RC206356L1 Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC206356L2 Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, mGFP tagged 10 ug
$600.00
RC206356L3 Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC206356L4 Lenti ORF clone of Human CD200 molecule (CD200), transcript variant 1, mGFP tagged 10 ug
$600.00
RG206356 CD200 (tGFP-tagged) - Human CD200 molecule (CD200), transcript variant 1 10 ug
$489.00 $500.00
SC108879 CD200 (untagged)-Human CD200 molecule (CD200), transcript variant 1 10 ug
$300.00

Plasmid Map for RC206356

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC206356
Circular map for RC206356

file-alt Citations

Forced expression of CD200 improves the differentiation capability and immunoregulatory functions of mesenchymal stromal cells
Kim, Kim, Kwon et al
Biotechnol. Lett. (2018)
AI Summary: OriGene’s CD200 Human cDNA ORF Clone was used as the source of the human CD200 gene for forced expression experiments, enabling the study of its effects on mesenchymal stromal cell differentiation and immunoregulatory functions.
Snippet: The coding region of human CD200 from the CD200 Human cDNA ORF Clone (Origene, Rockville, MD, USA) was amplified by polymerase chain reaction (PCR) (Table 1) and cloned into the pEGFP-C1 expression vector (Takara Bio, Shiga, Japan)
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products