OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DPPA4 (NM_018189) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205999
DPPA4 (Myc-DDK-tagged)-Human developmental pluripotency associated 4 (DPPA4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA800026 DPPA4 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3) 100 ul
$447.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "DPPA4 or NM_018189"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol DPPA4
Synonyms 2410091M23Rik
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205999 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTGCGAGGCTCCGCTTCTTCTACAAGTATGGAGAAGGCAAAAGGCAAGGAGTGGACCTCCACAGAGA
AGTCGAGGGAAGAGGATCAGCAGGCTTCTAATCAACCAAATTCAATTGCTTTGCCAGGAACATCAGCAAA
GAGAACCAAAGAAAAAATGTCTGTCAAAGGCAGTAAAGTGCTCTGCCCTAAGAAAAAGGCAGAGCACACT
GACAACCCCAGACCTCAGAAGAAGATACCAATCCCTCCATTACCTTCTAAACTGCCACCTGTTAATCTGA
TTCACCGGGACATTCTGCGGGCCTGGTGCCAACAATTGAAGCTGAGCTCCAAAGGCCAGAAATTGGATGC
ATATAAGCGCCTGTGTGCCTTTGCCTACCCAAATCAAAAGGATTTTCCTAGCACAGCAAAAGAGGCCAAA
ATCCGGAAATCATTGCAAAAAAAATTAAAGGTGGAAAAGGGGGAAACGTCCCTGCAAAGTTCTGAGACAC
ATCCTCCTGAAGTGGCTCTTCCTCCTGTGGGGGAGCCGCCTGCCCTGGAAAATTCCACTGCTCTCCTTGA
GGGAGTTAATACAGTTGTGGTGACAACTTCTGCCCCAGAGGCTTTGCTGGCCTCCTGGGCGAGAATTTCA
GCCAGGGCGAGGACACCAGAGGCAGTGGAATCTCCACAAGAGGCCTCTGGTGTCAGGTGGTGTGTGGTCC
ATGGGAAAAGTCTCCCTGCAGACACAGATGGTTGGGTTCACCTGCAGTTTCATGCTGGTCAAGCCTGGGT
TCCAGAAAAGCAAGAAGGGAGAGTGAGTGCACTCTTCTTGCTTCCTGCCTCCAATTTTCCACCCCCGCAC
CTTGAAGACAATATGTTGTGCCCCAAATGTGTTCACAGGAACAAGGTCTTAATAAAAAGCCTCCAATGGG
AA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205999 protein sequence
Red=Cloning site Green=Tags(s)

MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTKEKMSVKGSKVLCPKKKAEHT
DNPRPQKKIPIPPLPSKLPPVNLIHRDILRAWCQQLKLSSKGQKLDAYKRLCAFAYPNQKDFPSTAKEAK
IRKSLQKKLKVEKGETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWARIS
ARARTPEAVESPQEASGVRWCVVHGKSLPADTDGWVHLQFHAGQAWVPEKQEGRVSALFLLPASNFPPPH
LEDNMLCPKCVHRNKVLIKSLQWE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_018189
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_018189.2, NP_060659.2
RefSeq Size 2823 bp
RefSeq ORF 915 bp
Locus ID 55211
UniProt ID Q7L190
Cytogenetics 3q13.13
MW 33.5 kDa
Summary This gene encodes a nuclear factor that is involved in the maintenance of pluripotency in stem cells and essential for embryogenesis. The encoded protein has a scaffold-attachment factor A/B, acinus and PIAS (SAP) domain that binds DNA and is thought to modify chromatin. Mice with a homozygous knockout of the orthologous gene die during late embryonic development or within hours after birth. Knockout embryos are normal in size at embryonic day 18.5 but exhibit skeletal and lung tissue abnormalities. This gene, when mutated, is highly expressed in embryonal carcinomas, pluripotent germ cell tumors, and other cancers and is thought to play an important role in tumor progression. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants. provided by RefSeq, Feb 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_018189" in other vectors (4)
SKU Description Size Price
RC205999L3 Lenti ORF clone of Human developmental pluripotency associated 4 (DPPA4), Myc-DDK-tagged 10 ug
$600.00
RC205999L4 Lenti ORF clone of Human developmental pluripotency associated 4 (DPPA4), mGFP tagged 10 ug
$600.00
RG205999 DPPA4 (tGFP-tagged) - Human developmental pluripotency associated 4 (DPPA4) 10 ug
$489.00 $500.00
SC126928 DPPA4 (untagged)-Human developmental pluripotency associated 4 (DPPA4) 10 ug
$300.00

Plasmid Map for RC205999

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205999
Circular map for RC205999

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products