OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

IFI30 (NM_006332) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205877
IFI30 (Myc-DDK-tagged)-Human interferon, gamma-inducible protein 30 (IFI30)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA307992 Rabbit polyclonal antibody to GILT (interferon, gamma-inducible protein 30)
100 ul
$665.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "IFI30 or NM_006332"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol IFI30
Synonyms GILT; IFI-30; IP-30; IP30
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205877 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACCCTGTCGCCACTTCTGCTGTTCCTGCCACCGCTGCTGCTGCTGCTGGACGTCCCCACGGCGGCGG
TGCAGGCGTCCCCTCTGCAAGCGTTAGACTTCTTTGGGAATGGGCCACCAGTTAACTACAAGACAGGCAA
TCTATACCTGCGGGGGCCCCTGAAGAAGTCCAATGCACCGCTTGTCAATGTGACCCTCTACTATGAAGCA
CTGTGCGGTGGCTGCCGAGCCTTCCTGATCCGGGAGCTCTTCCCAACATGGCTGTTGGTCATGGAGATCC
TCAATGTCACGCTGGTGCCCTACGGAAACGCACAGGAACAAAATGTCAGTGGCAGGTGGGAGTTCAAGTG
CCAGCATGGAGAAGAGGAGTGCAAATTCAACAAGGTGGAGGCCTGCGTGTTGGATGAACTTGACATGGAG
CTAGCCTTCCTGACCATTGTCTGCATGGAAGAGTTTGAGGACATGGAGAGAAGTCTGCCACTATGCCTGC
AGCTCTACGCCCCAGGGCTGTCGCCAGACACTATCATGGAGTGTGCAATGGGGGACCGCGGCATGCAGCT
CATGCACGCCAACGCCCAGCGGACAGATGCTCTCCAGCCACCACACGAGTATGTGCCCTGGGTCACCGTC
AATGGGAAACCCTTGGAAGATCAGACCCAGCTCCTTACCCTTGTCTGCCAGTTGTACCAGGGCAAGAAGC
CGGATGTCTGCCCTTCCTCAACCAGCTCCCTCAGGAGTGTTTGCTTCAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205877 protein sequence
Red=Cloning site Green=Tags(s)

MTLSPLLLFLPPLLLLLDVPTAAVQASPLQALDFFGNGPPVNYKTGNLYLRGPLKKSNAPLVNVTLYYEA
LCGGCRAFLIRELFPTWLLVMEILNVTLVPYGNAQEQNVSGRWEFKCQHGEEECKFNKVEACVLDELDME
LAFLTIVCMEEFEDMERSLPLCLQLYAPGLSPDTIMECAMGDRGMQLMHANAQRTDALQPPHEYVPWVTV
NGKPLEDQTQLLTLVCQLYQGKKPDVCPSSTSSLRSVCFK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_006332
ORF Size 750 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_006332.5
RefSeq Size 1034 bp
RefSeq ORF 753 bp
Locus ID 10437
UniProt ID P13284, A0A024R7N7
Cytogenetics 19p13.11
Protein Pathways Antigen processing and presentation
MW 28 kDa
Summary The protein encoded by this gene is a lysosomal thiol reductase that at low pH can reduce protein disulfide bonds. The enzyme is expressed constitutively in antigen-presenting cells and induced by gamma-interferon in other cell types. This enzyme has an important role in MHC class II-restricted antigen processing. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_006332" in other vectors (4)
SKU Description Size Price
RC205877L3 Lenti ORF clone of Human interferon, gamma-inducible protein 30 (IFI30), Myc-DDK-tagged 10 ug
$600.00
RC205877L4 Lenti ORF clone of Human interferon, gamma-inducible protein 30 (IFI30), mGFP tagged 10 ug
$600.00
RG205877 IFI30 (tGFP-tagged) - Human interferon, gamma-inducible protein 30 (IFI30) 10 ug
$489.00 $500.00
SC319564 IFI30 (untagged)-Human interferon, gamma-inducible protein 30 (IFI30) 10 ug
$300.00

Plasmid Map for RC205877

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205877
Circular map for RC205877

file-alt Citations

GILT restricts the cellular entry mediated by the envelope glycoproteins of SARS-CoV, Ebola virus and Lassa fever virus
Chen, Hou, Jiang et al
Emerg Microbes Infect (2019) 8 (1), 1511-1523 DOI: 10.1080/22221751.2019.1677446
AI Summary: OriGene’s GILT (NM_006332) cDNA Clone (RC205877) was used in this study to overexpress GILT and investigate its role in restricting viral entry mediated by the envelope glycoproteins of SARS-CoV, Ebola virus, and Lassa fever virus.
Snippet: Anti-cathepsin S (ab134157) was obtained from Abcam. Plasmid construction GILT (NM_006332) cDNA Clone was purchased from Origene (RC205877) and cloned into pcDNA5/FRT/ ΔCAT vector between BamH I and Not I sites
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products