OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

KCTD11 (NM_001002914) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205782
KCTD11 (Myc-DDK-tagged)-Human potassium channel tetramerisation domain containing 11 (KCTD11)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA341730 Rabbit Polyclonal Anti-KCTD11 Antibody
100 ul
$525.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "KCTD11 or NM_001002914"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol KCTD11
Synonyms C17orf36; KCASH1; REN; REN/KCTD11
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205782 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTGGGGGCCATGTTTAGGGCCGGCACCCCCATGCCCCCCAACCTCAATTCCCAAGGAGGCGGCCACT
ACTTCATCGACCGGGATGGCAAGGCCTTCCGGCACATCCTCAATTTCCTGAGGCTGGGCCGCCTGGACCT
GCCCCGTGGGTACGGAGAGACAGCGCTGCTCAGGGCAGAGGCTGACTTCTACCAGATCCGGCCCCTCCTG
GATGCGCTGCGGGAACTGGAGGCCTCTCAGGGGACCCCTGCACCCACAGCTGCCCTGCTCCACGCAGATG
TAGATGTCAGCCCCCGCCTGGTGCACTTCTCTGCTCGCCGGGGACCCCATCACTATGAGCTGAGCTCCGT
CCAGGTGGACACCTTCCGAGCCAACCTTTTCTGCACCGACTCTGAGTGTCTAGGTGCTTTGCGGGCCCGA
TTTGGTGTGGCCAGTGGGGATAGGGCAGAGGGGAGCCCACATTTTCATCTGGAGTGGGCCCCCCGCCCCG
TGGAACTCCCCGAGGTGGAGTATGGGAGACTGGGGCTGCAGCCGCTGTGGACTGGGGGGCCAGGAGAGCG
GCGGGAGGTGGTGGGCACCCCAAGCTTCCTGGAGGAGGTGCTGCGGGTGGCTCTCGAGCACGGCTTCCGA
CTAGACTCTGTCTTCCCCGACCCCGAAGACCTGCTCAACTCCAGGTCTCTGCGCTTTGTCCGGCAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205782 protein sequence
Red=Cloning site Green=Tags(s)

MLGAMFRAGTPMPPNLNSQGGGHYFIDRDGKAFRHILNFLRLGRLDLPRGYGETALLRAEADFYQIRPLL
DALRELEASQGTPAPTAALLHADVDVSPRLVHFSARRGPHHYELSSVQVDTFRANLFCTDSECLGALRAR
FGVASGDRAEGSPHFHLEWAPRPVELPEVEYGRLGLQPLWTGGPGERREVVGTPSFLEEVLRVALEHGFR
LDSVFPDPEDLLNSRSLRFVRH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene |
ACCN NM_001002914
ORF Size 696 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001002914.2
RefSeq Size 3081 bp
RefSeq ORF 699 bp
Locus ID 147040
UniProt ID Q693B1, A0A158RFT7
Cytogenetics 17p13.1
Protein Families Ion Channels: Other
MW 25.9 kDa
Summary Plays a role as a marker and a regulator of neuronal differentiation; Up-regulated by a variety of neurogenic signals, such as retinoic acid, epidermal growth factor/EGF and NGFB/nerve growth factor. Induces apoptosis, growth arrest and the expression of cyclin-dependent kinase inhibitor CDKN1B. Plays a role as a tumor repressor and inhibits cell growth and tumorigenicity of medulloblastoma (MDB). Acts as probable substrate-specific adapter for a BCR (BTB-CUL3-RBX1) E3 ubiquitin-protein ligase complex towards HDAC1. Functions as antagonist of the Hedgehog pathway on cell proliferation and differentiation by affecting the nuclear transfer of transcription factor GLI1, thus maintaining cerebellar granule cells in undifferentiated state, this effect probably occurs via HDAC1 down-regulation, keeping GLI1 acetylated and inactive. When knock-down, Hedgehog antagonism is impaired and proliferation of granule cells is sustained. Activates the caspase cascade.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001002914" in other vectors (6)
SKU Description Size Price
RC205782L1 Lenti ORF clone of Human potassium channel tetramerisation domain containing 11 (KCTD11), Myc-DDK-tagged 10 ug
$600.00
RC205782L2 Lenti ORF clone of Human potassium channel tetramerisation domain containing 11 (KCTD11), mGFP tagged 10 ug
$600.00
RC205782L3 Lenti ORF clone of Human potassium channel tetramerisation domain containing 11 (KCTD11), Myc-DDK-tagged 10 ug
$600.00
RC205782L4 Lenti ORF clone of Human potassium channel tetramerisation domain containing 11 (KCTD11), mGFP tagged 10 ug
$600.00
RG205782 KCTD11 (tGFP-tagged) - Human potassium channel tetramerisation domain containing 11 (KCTD11) 10 ug
$489.00 $500.00
SC121957 KCTD11 (untagged)-Human potassium channel tetramerisation domain containing 11 (KCTD11) 10 ug
$300.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products