COMMD1 (NM_152516) Human Tagged ORF Clone

SKU
RC205614
COMMD1 (Myc-DDK-tagged)-Human copper metabolism (Murr1) domain containing 1 (COMMD1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol COMMD1
Synonyms C2orf5; MURR1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205614 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGGCGAGCTTGAGGGTGGCAAACCCCTGAGCGGGCTGCTGAATGCGCTGGCCCAGGACACTT
TCCACGGGTACCCCGGCATCACAGAGGAGCTGCTACGGAGCCAGCTATATCCAGAGGTGCCACCCGAGGA
GTTCCGCCCCTTTCTGGCAAAGATGAGGGGGATTCTTAAGTCTATTGCGTCTGCAGACATGGATTTCAAC
CAGCTGGAGGCATTCTTGACTGCTCAAACCAAAAAGCAAGGTGGGATCACATCTGACCAAGCTGCTGTCA
TTTCCAAATTCTGGAAGAGCCACAAGACAAAAATCCGTGAGAGCCTCATGAACCAGAGCCGCTGGAATAG
CGGGCTTCGGGGCCTGAGCTGGAGAGTTGATGGCAAGTCTCAGTCAAGGCACTCAGCTCAAATACACACA
CCTGTTGCCATTATAGAGCTGGAATTAGGCAAATATGGACAGGAATCTGAATTTCTGTGTTTGGAATTTG
ACGAGGTCAAAGTCAACCAAATTCTGAAGACGCTGTCAGAGGTAGAAGAAAGTATCAGCACACTGATCAG
CCAGCCTAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC205614 protein sequence
Red=Cloning site Green=Tags(s)

MAAGELEGGKPLSGLLNALAQDTFHGYPGITEELLRSQLYPEVPPEEFRPFLAKMRGILKSIASADMDFN
QLEAFLTAQTKKQGGITSDQAAVISKFWKSHKTKIRESLMNQSRWNSGLRGLSWRVDGKSQSRHSAQIHT
PVAIIELELGKYGQESEFLCLEFDEVKVNQILKTLSEVEESISTLISQPN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_152516
ORF Size 570 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152516.1
RefSeq Size 725 bp
RefSeq ORF 573 bp
Locus ID 150684
UniProt ID Q8N668
Cytogenetics 2p15
MW 21.2 kDa
Summary COMMD1 is a regulator of copper homeostasis, sodium uptake, and NF-kappa-B (see MIM 164011) signaling (de Bie et al., 2005 [PubMed 16267171]).[supplied by OMIM, Sep 2009]
Write Your Own Review
You're reviewing:COMMD1 (NM_152516) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC205614L1 Lenti ORF clone of Human copper metabolism (Murr1) domain containing 1 (COMMD1), Myc-DDK-tagged 10 ug
$600.00
RC205614L2 Lenti ORF clone of Human copper metabolism (Murr1) domain containing 1 (COMMD1), mGFP tagged 10 ug
$600.00
RC205614L3 Lenti ORF clone of Human copper metabolism (Murr1) domain containing 1 (COMMD1), Myc-DDK-tagged 10 ug
$600.00
RC205614L4 Lenti ORF clone of Human copper metabolism (Murr1) domain containing 1 (COMMD1), mGFP tagged 10 ug
$600.00
RG205614 COMMD1 (tGFP-tagged) - Human copper metabolism (Murr1) domain containing 1 (COMMD1) 10 ug
$489.00 MSRP $500.00 MSRP $500.00
SC128131 COMMD1 (untagged)-Human copper metabolism (Murr1) domain containing 1 (COMMD1) 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.