OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ANKRD1 (NM_014391) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205609
ANKRD1 (Myc-DDK-tagged)-Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA349471 Rabbit Polyclonal Anti-ANKRD1 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ANKRD1 or NM_014391"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ANKRD1
Synonyms ALRP; bA320F15.2; C-193; CARP; CVARP; MCARP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205609 representing NM_014391
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGGTACTGAAAGTAGAGGAACTGGTCACTGGAAAGAAGAATGGCAATGGGGAGGCAGGGGAATTCC
TTCCTGAGGATTTCAGAGATGGAGAGTATGAAGCTGCTGTTACTTTAGAGAAGCAGGAGGATCTGAAGAC
ACTTCTAGCCCACCCTGTGACCCTGGGGGAGCAACAGTGGAAAAGCGAGAAACAACGAGAGGCAGAGCTC
AAAAAGAAAAAACTAGAACAAAGATCAAAGCTTGAAAATTTAGAAGACCTTGAAATAATCATTCAACTGA
AGAAAAGGAAAAAATACAGGAAAACTAAAGTTCCAGTTGTAAAGGAACCAGAACCTGAAATCATTACGGA
ACCTGTGGATGTGCCTACGTTTCTGAAGGCTGCTCTGGAGAATAAACTGCCAGTAGTAGAAAAATTCTTG
TCAGACAAGAACAATCCAGATGTTTGTGATGAGTATAAACGGACAGCTCTTCATAGAGCATGCTTGGAAG
GACATTTGGCAATTGTGGAGAAGTTAATGGAAGCTGGAGCCCAGATCGAATTCCGTGATATGCTTGAATC
CACAGCCATCCACTGGGCAAGCCGTGGAGGAAACCTGGATGTTTTAAAATTGTTGCTGAATAAAGGAGCA
AAAATTAGCGCCCGAGATAAGTTGCTCAGCACAGCGCTGCATGTGGCGGTGAGGACTGGCCACTATGAGT
GCGCGGAGCATCTTATCGCCTGTGAGGCAGACCTCAACGCCAAAGACAGAGAAGGAGATACCCCGTTGCA
TGATGCGGTGAGACTGAACCGCTATAAGATGATCCGACTCCTGATTATGTATGGCGCGGATCTCAACATC
AAGAACTGTGCTGGGAAGACGCCGATGGATCTGGTGCTACACTGGCAGAATGGAACCAAAGCAATATTCG
ACAGCCTCAGAGAGAACTCCTACAAGACCTCTCGCATAGCTACATTC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205609 representing NM_014391
Red=Cloning site Green=Tags(s)

MMVLKVEELVTGKKNGNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLLAHPVTLGEQQWKSEKQREAEL
KKKKLEQRSKLENLEDLEIIIQLKKRKKYRKTKVPVVKEPEPEIITEPVDVPTFLKAALENKLPVVEKFL
SDKNNPDVCDEYKRTALHRACLEGHLAIVEKLMEAGAQIEFRDMLESTAIHWASRGGNLDVLKLLLNKGA
KISARDKLLSTALHVAVRTGHYECAEHLIACEADLNAKDREGDTPLHDAVRLNRYKMIRLLIMYGADLNI
KNCAGKTPMDLVLHWQNGTKAIFDSLRENSYKTSRIATF

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_014391
ORF Size 957 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_014391.3
RefSeq Size 1994 bp
RefSeq ORF 960 bp
Locus ID 27063
UniProt ID Q15327
Cytogenetics 10q23.31
MW 36.1 kDa
Summary The protein encoded by this gene is localized to the nucleus of endothelial cells and is induced by IL-1 and TNF-alpha stimulation. Studies in rat cardiomyocytes suggest that this gene functions as a transcription factor. Interactions between this protein and the sarcomeric proteins myopalladin and titin suggest that it may also be involved in the myofibrillar stretch-sensor system. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_014391" in other vectors (7)
SKU Description Size Price
RC205609L1 Lenti ORF clone of Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1), Myc-DDK-tagged 10 ug
$600.00
RC205609L2 Lenti ORF clone of Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1), mGFP tagged 10 ug
$600.00
RC205609L3 Lenti ORF clone of Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1), Myc-DDK-tagged 10 ug
$600.00
RC205609L4 Lenti ORF clone of Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1), mGFP tagged 10 ug
$600.00
RG205609 ANKRD1 (tGFP-tagged) - Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1) 10 ug
$489.00 $500.00
SC304093 ANKRD1 (untagged)-Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1) 10 ug
$330.00
SC321099 ANKRD1 (untagged)-Human ankyrin repeat domain 1 (cardiac muscle) (ANKRD1) 10 ug
$300.00

Plasmid Map for RC205609

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205609
Circular map for RC205609

file-alt Citations

Ankyrin repeat domain 1 regulates innate immune responses against herpes simplex virus 1: A potential role in eczema herpeticum
Bin, Li, Richers et al
J. Allergy Clin. Immunol. (2018) 141 (6), 2085-2093.e1 DOI: 10.1016/j.jaci.2018.01.001
AI Summary: OriGene products, including Myc-DDK1-tagged IRF3 (RC220780), NFKB1 (RC208384), IRF7 (RC217934), ANKRD1 (RC205609), and STING, were used to study protein interactions and signaling pathways involved in the regulation of innate immune responses against herpes simplex virus 1 in this paper.
Snippet: (RC220780), Myc-DDK1-tagged NFKB1 (RC208384), Myc-DDK1-tagged IRF7 (RC217934), Myc-DDK1-tagged ANKRD1 (RC205609) and Myc-DDK1-tagged STING were purchased from OriGene (Rockville, MD). Dr. Hong-Bing Shu (Wuhan University, China) kindly
ANKRD1 modulates inflammatory responses IN C2C12 myoblasts through feedback inhibition OF NF-κB signaling activity
Liu, Bauman, Cardozo
Biochem. Biophys. Res. Commun. (2015)
Cited by 50
AI Summary: OriGene contributed to this study by providing the AnkrD1 expression plasmid and control vector, which were used to investigate the role of AnkrD1 in modulating NF-κB signaling in C2C12 myoblasts.
Snippet: Transient transfection was done using Lipofectamine 2000 reagent according to the manufacturer's instructions (Life Technologies, Grand Island, NY). The AnkrD1 expression plasmid and control vector were purchased from Origene (Rockville, MD). ... Cite SaveSaving
Inhibition of ANKRD1 sensitizes human ovarian cancer cells to endoplasmic reticulum stress-induced apoptosis
Lei, Henderson, Emmanuel et al
Oncogene (2014)
Cited by 74
AI Summary: OriGene’s Human ANKRD1 cDNA in the TrueORF pCMV6 entry vector was used to overexpress ANKRD1 in ovarian cancer cells, enabling the study of its role in modulating sensitivity to chemotherapy and endoplasmic reticulum stress-induced apoptosis.
Snippet: described. 66. DNA transfection. Human ANKRD1 cDNA in the TrueORF pCMV6 entry vector (OriGene Technologies, Rockville, MD, USA) was transfected into PEO14 cells using Lipofectamine 2000 (Life Technologies). PEO14 ... Cite SaveSaving
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products