OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

B3GALT2 (NM_003783) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205366
B3GALT2 (Myc-DDK-tagged)-Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "B3GALT2 or NM_003783"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol B3GALT2
Synonyms beta3Gal-T2; BETA3GALT2; GLCT2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205366 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCTTCAGTGGAGGAGAAGACACTGCTGCTTTGCAAAGATGACCTGGAATGCCAAAAGGTCTCTGTTCC
GCACTCATCTTATTGGAGTACTTTCTCTAGTGTTTCTTTTTGCTATGTTTTTGTTTTTCAATCATCATGA
CTGGCTGCCAGGCAGAGCTGGATTCAAAGAAAACCCTGTGACATACACTTTCCGAGGATTTCGGTCAACA
AAAAGTGAGACAAACCACAGCTCCCTTCGGAACATTTGGAAAGAAACAGTCCCTCAAACCCTGAGGCCTC
AAACAGCAACTAACTCTAATAACACAGACCTGTCACCACAAGGAGTTACAGGCCTGGAGAATACACTTAG
TGCCAATGGAAGTATTTACAATGAAAAAGGTACTGGACATCCAAATTCTTACCATTTCAAATATATTATT
AATGAGCCTGAAAAATGCCAAGAGAAAAGTCCTTTTTTAATACTACTAATAGCTGCAGAGCCTGGACAAA
TAGAAGCTAGAAGAGCTATTCGGCAAACTTGGGGCAATGAAAGTCTAGCACCTGGTATTCAAATCACAAG
AATATTTTTGTTGGGCTTAAGTATTAAGCTAAATGGCTACCTTCAACGTGCAATACTGGAAGAAAGCAGA
CAATATCATGATATAATTCAACAGGAATACTTAGATACGTACTATAATTTGACCATTAAAACACTAATGG
GCATGAACTGGGTTGCAACATACTGTCCACATATTCCATATGTTATGAAAACTGACAGTGACATGTTTGT
CAACACTGAATATTTAATCAATAAGTTACTGAAGCCAGATCTGCCTCCCAGACATAACTATTTCACTGGT
TACCTAATGCGAGGATATGCACCCAATCGAAACAAAGATAGCAAGTGGTACATGCCACCAGACCTCTACC
CAAGTGAGCGTTATCCTGTCTTCTGTTCTGGAACTGGTTATGTTTTTTCTGGAGATCTGGCAGAAAAGAT
TTTTAAAGTTTCTTTAGGTATCCGCCGTTTGCACTTGGAAGATGTATATGTAGGGATCTGTCTTGCCAAG
TTGAGAATTGATCCTGTACCCCCTCCCAATGAGTTTGTGTTCAATCACTGGCGAGTCTCTTATTCGAGCT
GTAAATACAGCCACCTAATTACCTCTCATCAGTTCCAGCCTAGTGAACTGATAAAATACTGGAACCATTT
ACAACAAAATAAGCACAATGCCTGTGCCAACGCAGCAAAAGAAAAGGCAGGCAGGTATCGCCACCGTAAA
CTACAT

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205366 protein sequence
Red=Cloning site Green=Tags(s)

MLQWRRRHCCFAKMTWNAKRSLFRTHLIGVLSLVFLFAMFLFFNHHDWLPGRAGFKENPVTYTFRGFRST
KSETNHSSLRNIWKETVPQTLRPQTATNSNNTDLSPQGVTGLENTLSANGSIYNEKGTGHPNSYHFKYII
NEPEKCQEKSPFLILLIAAEPGQIEARRAIRQTWGNESLAPGIQITRIFLLGLSIKLNGYLQRAILEESR
QYHDIIQQEYLDTYYNLTIKTLMGMNWVATYCPHIPYVMKTDSDMFVNTEYLINKLLKPDLPPRHNYFTG
YLMRGYAPNRNKDSKWYMPPDLYPSERYPVFCSGTGYVFSGDLAEKIFKVSLGIRRLHLEDVYVGICLAK
LRIDPVPPPNEFVFNHWRVSYSSCKYSHLITSHQFQPSELIKYWNHLQQNKHNACANAAKEKAGRYRHRK
LH

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003783
ORF Size 1266 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003783.3
RefSeq Size 3548 bp
RefSeq ORF 1269 bp
Locus ID 8707
UniProt ID O43825
Cytogenetics 1q31.2
Domains Galactosyl_T
Protein Families Transmembrane
Protein Pathways Glycosphingolipid biosynthesis - lacto and neolacto series, Metabolic pathways
MW 49.2 kDa
Summary This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine). The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5). This gene encodes a protein that functions in N-linked glycoprotein glycosylation and shows strict donor substrate specificity for UDP-galactose. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003783" in other vectors (6)
SKU Description Size Price
RC205366L1 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2), Myc-DDK-tagged 10 ug
$757.00
RC205366L2 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2), mGFP tagged 10 ug
$757.00
RC205366L3 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2), Myc-DDK-tagged 10 ug
$757.00
RC205366L4 Lenti ORF clone of Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2), mGFP tagged 10 ug
$757.00
RG205366 B3GALT2 (tGFP-tagged) - Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2) 10 ug
$489.00 $657.00
SC111083 B3GALT2 (untagged)-Human UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 2 (B3GALT2) 10 ug
$457.00

Plasmid Map for RC205366

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205366
Circular map for RC205366

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products