OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

SFRP4 (NM_003014) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC205365
SFRP4 (Myc-DDK-tagged)-Human secreted frizzled-related protein 4 (SFRP4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA305645 Goat Anti-SFRP4 Antibody
100 ug
$565.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "SFRP4 or NM_003014"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol SFRP4
Synonyms FRP-4; FRPHE; FRZB-2; PYL; sFRP-4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205365 representing NM_003014
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCGTGGCTGGCTGCGCTCCGAGCTGCGGAGTCCGGGACTGGAGCTGCCCGGGCGGGTTCGCGCCCC
GAAGGCTGAGAGCTGGCGCTGCTCGTGCCCTGTGTGCCAGACGGCGGAGCTCCGCGGCCGGACCCCGCGG
CCCCGTTTTGCTGCCGACTGGAGTTTGGGGGAAGAAACTCTCCTGCGCCCCAGAGGATTTCTTCCTCGGC
GAAGGGACAGCGAAAGATGAGGGTGGCAGGAAGAGAAGGGCGCTTTCTGTCTGCCGGGGTCGCAGCGCGA
GAGGGCAGTGCCATGTTCCTCTCCATCCTAGTGGCGCTGTGCCTGTGGCTGCACCTGGCGCTGGCGTGCG
CGGCGCGCCCTGCGAGGCGGTGCGCATCCCTATGTGCCGGCACATGCCCTGGAACATCACGCGGATGCCC
AACCACCTGCACCACAGCACGCAGGAGAACGCCATCCTGGCCATCGAGCAGTACGAGGAGCTGGTGGACG
TGAACTGCAGCGCCGTGCTGCGCTTCTTCCTCTGTGCCATGTACGCGCCCATTTGCACCCTGGAGTTCCT
GCACGACCCTATCAAGCCGTGCAAGTCGGTGTGCCAACGCGCGCGCGACGACTGCGAGCCCCTCATGAAG
ATGTACAACCACAGCTGGCCCGAAAGCCTGGCCTGCGACGAGCTGCCTGTCTATGACCGTGGCGTGTGCA
TCTCGCCTGAAGCCATCGTCACGGACCTCCCGGAGGATGTTAAGTGGATAGACATCACACCAGACATGAT
GGTACAGGAAAGGCCTCTTGATGTTGACTGTAAACGCCTAAGCCCCGATCGGTGCAAGTGTAAAAAGGTG
AAGCCAACTTTGGCAACGTATCTCAGCAAAAACTACAGCTATGTTATTCATGCCAAAATAAAAGCTGTGC
AGAGGAGTGGCTGCAATGAGGTCACAACGGTGGTGGATGTAAAAGAGATCTTCAAGTCCTCATCACCCAT
CCCTCGAACTCAAGTCCCGCTCATTACAAATTCTTCTTGCCAGTGTCCACACATCCTGCCCCATCAAGAT
GTTCTCATCATGTGTTACGAGTGGCGTTCAAGGATGATGCTTCTTGAAAATTGCTTAGTTGAAAAATGGA
GAGATCAGCTTAGTAAAAGATCCATACAGTGGGAAGAGAGGCTGCAGGAACAGCGGAGAACAGTTCAGGA
CAAGAAGAAAACAGCCGGGCGCACCAGTCGTAGTAATCCCCCCAAACCAAAGGGAAAGCCTCCTGCTCCC
AAACCAGCCAGTCCCAAGAAGAACATTAAAACTAGGAGTGCCCGGAAGAGAACAAACCCGAAAAGAGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205365 representing NM_003014
Red=Cloning site Green=Tags(s)

MAVAGCAPSCGVRDWSCPGGFAPRRLRAGAARALCARRRSSAAGPRGPVLLPTGVWGKKLSCAPEDFFLG
EGTAKDEGGRKRRALSVCRGRSARGQCHVPLHPSGAVPVAAPGAGVRGAPCEAVRIPMCRHMPWNITRMP
NHLHHSTQENAILAIEQYEELVDVNCSAVLRFFLCAMYAPICTLEFLHDPIKPCKSVCQRARDDCEPLMK
MYNHSWPESLACDELPVYDRGVCISPEAIVTDLPEDVKWIDITPDMMVQERPLDVDCKRLSPDRCKCKKV
KPTLATYLSKNYSYVIHAKIKAVQRSGCNEVTTVVDVKEIFKSSSPIPRTQVPLITNSSCQCPHILPHQD
VLIMCYEWRSRMMLLENCLVEKWRDQLSKRSIQWEERLQEQRRTVQDKKKTAGRTSRSNPPKPKGKPPAP
KPASPKKNIKTRSARKRTNPKRV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_003014
ORF Size 1329 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq Size 2820 bp
RefSeq ORF 1041 bp
Locus ID 6424
UniProt ID Q6FHJ7
Cytogenetics 7p14.1
Domains FRI, NTR
Protein Families Adult stem cells, Cancer stem cells, Druggable Genome, ES Cell Differentiation/IPS, Secreted Protein, Stem cell relevant signaling - Wnt Signaling pathway
Protein Pathways Wnt signaling pathway
MW 49.56 kDa
Summary Secreted frizzled-related protein 4 (SFRP4) is a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. SFRPs act as soluble modulators of Wnt signaling. The expression of SFRP4 in ventricular myocardium correlates with apoptosis related gene expression. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_003014" in other vectors (6)
SKU Description Size Price
RC205365L1 Lenti ORF clone of Human secreted frizzled-related protein 4 (SFRP4), Myc-DDK-tagged 10 ug
$757.00
RC205365L2 Lenti ORF clone of Human secreted frizzled-related protein 4 (SFRP4), mGFP tagged 10 ug
$757.00
RC205365L3 Lenti ORF clone of Human secreted frizzled-related protein 4 (SFRP4), Myc-DDK-tagged 10 ug
$757.00
RC205365L4 Lenti ORF clone of Human secreted frizzled-related protein 4 (SFRP4), mGFP tagged 10 ug
$757.00
RG205365 SFRP4 (tGFP-tagged) - Human secreted frizzled-related protein 4 (SFRP4) 10 ug
$489.00 $657.00
SC118247 SFRP4 (untagged)-Human secreted frizzled-related protein 4 (SFRP4) 10 ug
$457.00

Plasmid Map for RC205365

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205365
Circular map for RC205365

file-alt Citations

Non-Canonical Wnt Predominates in Activated Rat Hepatic Stellate Cells, Influencing HSC Survival and Paracrine Stimulation of Kupffer Cells
Corbett, Mann, Mann
PLoS ONE (2015) 10 (11), e0142794 DOI: 10.1371/journal.pone.0142794
Cited by 42
AI Summary: OriGene products—specifically Wnt3a, Wnt5a, Wnt10b, LEF1, and sFRP4 constructs—were used to investigate the roles of canonical and non-canonical Wnt signaling in hepatic stellate cell activation and their effects on cell survival and paracrine signaling.
Snippet: Active β-catenin construct (S37A) was provided by D.L.Johnson, as used in Orford et al[42]. Wnt3a, Wnt5a, Wnt10b, LEF1 and sFRP4 constructs were sourced from Origene
FigureFigureFigure
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products