OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RIC3 (NM_024557) Human Tagged ORF Clone

  • TrueORF®
Be the first to review this product
SKU
RC205179
RIC3 (Myc-DDK-tagged)-Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
5 Days*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA370586 RIC3 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "RIC3 or NM_024557"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol RIC3
Synonyms AYST720; PRO1385
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC205179 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGTACTCCACAGTGCAGAGAGTCGCTCTGGCTTCTGGGCTTGTCCTGGCTCTGTCGCTGCTGCTGC
CCAAGGCCTTCCTGTCCCGCGGGAAGCGGCAGGAGCCGCCGCCGACACCTGAAGGAAAATTGGGCCGATT
TCCACCTATGATGCATCATCACCAGGCACACTCAGATGGCCAGACTCCTGGGGCTCGTTTCCAGAGGTCT
CACCTTGCCGAGGCATTTGCAAAGGCCAAAGGATCAGGTGGAGGTGCTGGAGGAGGAGGTAGTGGAAGAG
GTCTGATGGGGCAGATTATTCCGATCTACGGTTTTGGGATTTTTTTATATATACTGTACATTCTATTTAA
GCTCTCAAAGGGGAAAACAACTGCAGAGGATGGGAAATGCTATACTGCCATGCCTGGAAACACCCACAGG
AAAATTACCAGTTTTGAGCTTGCTCAACTGCAAGAAAAACTGAAGGAGACAGAAGCAGCCATGGAAAAAT
TATTCAACAGAGTGGGACCTAATGGTGAGAGAGCACAGACTGTGACTTCTGACCAAGAGAAACGGTTGCT
ACATCAGCTCCGAGAAATCACCAGGGTCATGAAAGAAGGAAAATTCATTGACAGATTTTCTCCAGAGAAA
GAAGCTGAGGAGGCCCCTTACATGGAGGACTGGGAAGGTTACCCTGAAGAGACTTACCCAATTTATGACC
TTTCAGACTGTATCAAGCGTAGGCAAGAAACAATCTTGGTGGATTACCCTGACCCAAAAGAACTTTCTGC
TGAAGAAATAGCTGAAAGAATGGGAATGATAGAAGAGGAAGAATCAGATCATTTGGGTTGGGAAAGTCTG
CCCACTGACCCCAGAGCCCAGGAAGATAATTCTGTTACCTCGTGTGATCCAAAGCCAGAAACATGTTCCT
GCTGTTTTCATGAAGACGAGGATCCTGCTGTCTTGGCAGAGAATGCTGGATTCAGTGCAGATAGCTACCC
TGAGCAAGAGGAAACCACCAAAGAAGAGTGGTCCCAAGACTTTAAAGATGAAGGGTTGGGCATCAGCACA
GATAAAGCATATACAGGCAGCATGCTGAGGAAGCGTAACCCCCAGGGTTTAGAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC205179 protein sequence
Red=Cloning site Green=Tags(s)

MAYSTVQRVALASGLVLALSLLLPKAFLSRGKRQEPPPTPEGKLGRFPPMMHHHQAHSDGQTPGARFQRS
HLAEAFAKAKGSGGGAGGGGSGRGLMGQIIPIYGFGIFLYILYILFKLSKGKTTAEDGKCYTAMPGNTHR
KITSFELAQLQEKLKETEAAMEKLFNRVGPNGERAQTVTSDQEKRLLHQLREITRVMKEGKFIDRFSPEK
EAEEAPYMEDWEGYPEETYPIYDLSDCIKRRQETILVDYPDPKELSAEEIAERMGMIEEEESDHLGWESL
PTDPRAQEDNSVTSCDPKPETCSCCFHEDEDPAVLAENAGFSADSYPEQEETTKEEWSQDFKDEGLGIST
DKAYTGSMLRKRNPQGLE

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_024557
ORF Size 1104 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_024557.2, NP_078833.2
RefSeq Size 5827 bp
RefSeq ORF 1107 bp
Locus ID 79608
UniProt ID Q7Z5B4, A0A0S2Z607
Cytogenetics 11p15.4
Protein Families Transmembrane
MW 41.1 kDa
Summary This gene encodes a member of the resistance to inhibitors of cholinesterase 3-like family which functions as a chaperone of specific 5-hydroxytryptamine type 3 receptor and nicotinic acetylcholine receptor subtypes. The encoded protein influences the folding and assembly of these receptor subunits in the endoplasmic reticulum and expression on the cell surface. This protein contains an N-terminal transmembrane domain, a proline-rich spacer, and a cytosolic C-terminal coiled-coil domain. Alternative splicing results in multiple transcript variants. provided by RefSeq, Oct 2016
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_024557" in other vectors (6)
SKU Description Size Price
RC205179L1 Lenti ORF clone of Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC205179L2 Lenti ORF clone of Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1, mGFP tagged 10 ug
$757.00
RC205179L3 Lenti ORF clone of Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1, Myc-DDK-tagged 10 ug
$757.00
RC205179L4 Lenti ORF clone of Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1, mGFP tagged 10 ug
$757.00
RG205179 RIC3 (tGFP-tagged) - Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1 10 ug
$489.00 $657.00
SC112180 RIC3 (untagged)-Human resistance to inhibitors of cholinesterase 3 homolog (C. elegans) (RIC3), transcript variant 1 10 ug
$457.00

Plasmid Map for RC205179

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC205179
Circular map for RC205179

file-alt Citations

Why Does Knocking Out NACHO, But Not RIC3, Completely Block Expression of α7 Nicotinic Receptors in Mouse Brain?
Deshpande, Vinayakamoorthy, Garg et al
Biomolecules (2020) 10 (3) DOI: 10.3390/biom10030470
Cited by 17
AI Summary: In this study, the mouse alpha7 nicotinic acetylcholine receptor plasmid in pCMV6 with a DDK (FLAG) tag (OriGene catalog MR224522) was used to investigate the roles of NACHO and RIC3 in α7nAChR expression.
Snippet: While addressing these specific objectives, our findings generate new questions about the interactions between NACHO and RIC3. 2. …Mouse alpha7 in pCMV6 with a DDK (FLAG) tag was purchased from Origene (catalog MR224522 Cached;- While addressing these specific objectives, our findings generate new questions about the interactions between NACHO and RIC3. 2. …Mouse alpha7 in pCMV6 with a DDK (FLAG) tag was purchased from Origene (catalog MR224522 Cached
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products