OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

BACE2 (NM_012105) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204860
BACE2 (Myc-DDK-tagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $482.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA306031 Rabbit Polyclonal BACE2 Antibody
100 ug
$640.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "BACE2 or NM_012105"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol BACE2
Synonyms AEPLC; ALP56; ASP1; ASP21; BAE2; CDA13; CEAP1; DRAP
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204860 representing NM_012105
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGCGCACTGGCCCGGGCGCTGCTGCTGCCTCTGCTGGCCCAGTGGCTCCTGCGCGCCGCCCCGGAGC
TGGCCCCCGCGCCCTTCACGCTGCCCCTCCGGGTGGCCGCGGCCACGAACCGCGTAGTTGCGCCCACCCC
GGGACCCGGGACCCCTGCCGAGCGCCACGCCGACGGCTTGGCGCTCGCCCTGGAGCCTGCCCTGGCGTCC
CCCGCGGGCGCCGCCAACTTCTTGGCCATGGTAGACAACCTGCAGGGGGACTCTGGCCGCGGCTACTACC
TGGAGATGCTGATCGGGACCCCCCCGCAGAAGCTACAGATTCTCGTTGACACTGGAAGCAGTAACTTTGC
CGTGGCAGGAACCCCGCACTCCTACATAGACACGTACTTTGACACAGAGAGGTCTAGCACATACCGCTCC
AAGGGCTTTGACGTCACAGTGAAGTACACACAAGGAAGCTGGACGGGCTTCGTTGGGGAAGACCTCGTCA
CCATCCCCAAAGGCTTCAATACTTCTTTTCTTGTCAACATTGCCACTATTTTTGAATCAGAGAATTTCTT
TTTGCCTGGGATTAAATGGAATGGAATACTTGGCCTAGCTTATGCCACACTTGCCAAGCCATCAAGTTCT
CTGGAGACCTTCTTCGACTCCCTGGTGACACAAGCAAACATCCCCAACGTTTTCTCCATGCAGATGTGTG
GAGCCGGCTTGCCCGTTGCTGGATCTGGGACCAACGGAGGTAGTCTTGTCTTGGGTGGAATTGAACCAAG
TTTGTATAAAGGAGACATCTGGTATACCCCTATTAAGGAAGAGTGGTACTACCAGATAGAAATTCTGAAA
TTGGAAATTGGAGGCCAAAGCCTTAATCTGGACTGCAGAGAGTATAACGCAGACAAGGCCATCGTGGACA
GTGGCACCACGCTGCTGCGCCTGCCCCAGAAGGTGTTTGATGCGGTGGTGGAAGCTGTGGCCCGCGCATC
TCTGATTCCAGAATTCTCTGATGGTTTCTGGACTGGGTCCCAGCTGGCGTGCTGGACGAATTCGGAAACA
CCTTGGTCTTACTTCCCTAAAATCTCCATCTACCTGAGAGATGAGAACTCCAGCAGGTCATTCCGTATCA
CAATCCTGCCTCAGCTTTACATTCAGCCCATGATGGGGGCCGGCCTGAATTATGAATGTTACCGATTCGG
CATTTCCCCATCCACAAATGCGCTGGTGATCGGTGCCACGGTGATGGAGGGCTTCTACGTCATCTTCGAC
AGAGCCCAGAAGAGGGTGGGCTTCGCAGCGAGCCCCTGTGCAGAAATTGCAGGTGCTGCAGTGTCTGAAA
TTTCCGGGCCTTTCTCAACAGAGGATGTAGCCAGCAACTGTGTCCCCGCTCAGTCTTTGAGCGAGCCCAT
TTTGTGGATTGTGTCCTATGCGCTCATGAGCGTCTGTGGAGCCATCCTCCTTGTCTTAATCGTCCTGCTG
CTGCTGCCGTTCCGGTGTCAGCGTCGCCCCCGTGACCCTGAGGTCGTCAATGATGAGTCCTCTCTGGTCA
GACATCGCTGGAAA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204860 representing NM_012105
Red=Cloning site Green=Tags(s)

MGALARALLLPLLAQWLLRAAPELAPAPFTLPLRVAAATNRVVAPTPGPGTPAERHADGLALALEPALAS
PAGAANFLAMVDNLQGDSGRGYYLEMLIGTPPQKLQILVDTGSSNFAVAGTPHSYIDTYFDTERSSTYRS
KGFDVTVKYTQGSWTGFVGEDLVTIPKGFNTSFLVNIATIFESENFFLPGIKWNGILGLAYATLAKPSSS
LETFFDSLVTQANIPNVFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSLYKGDIWYTPIKEEWYYQIEILK
LEIGGQSLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAVARASLIPEFSDGFWTGSQLACWTNSET
PWSYFPKISIYLRDENSSRSFRITILPQLYIQPMMGAGLNYECYRFGISPSTNALVIGATVMEGFYVIFD
RAQKRVGFAASPCAEIAGAAVSEISGPFSTEDVASNCVPAQSLSEPILWIVSYALMSVCGAILLVLIVLL
LLPFRCQRRPRDPEVVNDESSLVRHRWK

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_012105
ORF Size 1554 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_012105.5
RefSeq Size 2993 bp
RefSeq ORF 1557 bp
Locus ID 25825
UniProt ID Q9Y5Z0
Cytogenetics 21q22.2-q22.3
Domains asp
Protein Families Druggable Genome, Protease, Transmembrane
Protein Pathways Alzheimer's disease
MW 56.18 kDa
Summary This gene encodes an integral membrane glycoprotein that functions as an aspartic protease. The encoded protein cleaves amyloid precursor protein into amyloid beta peptide, which is a critical step in the etiology of Alzheimer's disease and Down syndrome. The protein precursor is further processed into an active mature peptide. Alternative splicing results in multiple transcript variants. provided by RefSeq, Jul 2013
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_012105" in other vectors (7)
SKU Description Size Price
RC204860L1 Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, Myc-DDK-tagged 10 ug
$782.00
RC204860L2 Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mGFP tagged 10 ug
$782.00
RC204860L3 Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, Myc-DDK-tagged 10 ug
$782.00
RC204860L4 Lenti ORF clone of Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a, mGFP tagged 10 ug
$782.00
RG204860 BACE2 (tGFP-tagged) - Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a 10 ug
$489.00 $682.00
SC110343 BACE2 (untagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a 10 ug
$483.00
SC320428 BACE2 (untagged)-Human beta-site APP-cleaving enzyme 2 (BACE2), transcript variant a 10 ug
$483.00

Plasmid Map for RC204860

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204860
Circular map for RC204860

file-alt Citations

Design and Synthesis of Clinical Candidate PF-06751979: A Potent, Brain Penetrant, β-Site Amyloid Precursor Protein Cleaving Enzyme 1 (BACE1) Inhibitor Lacking Hypopigmentation
O'Neill, Beck, Butler et al
J. Med. Chem. (2018)
AI Summary: OriGene’s RC204860 vector was used to generate a stable HEK293 cell line expressing human full-length BACE2, providing the cell membranes necessary for BACE2 radioligand binding assays in this study.
Snippet: vector (Origene RC204860) using lipofectamine LTX transfection system (Life Technology #15338100). A stable cell batch was generated by maintaining these cells under geneticin selection. The resultant clonal HEK293 stable cell line expressing human FL BACE2 was scaled up for production of crude BACE2 cell membrane used for the BACE2 radioligand binding assay
Identification of Human Islet Amyloid Polypeptide as a BACE2 Substrate
Rulifson, Cao, Miao et al
PLoS ONE (2016) 11 (2), e0147254 DOI: 10.1371/journal.pone.0147254
Cited by 39
AI Summary: OriGene products contributed to this study by providing plasmid DNA and an anti-DDK monoclonal antibody, which were used for the detection and analysis of human IAPP, BACE2, and BACE1 proteins.
Snippet: Cell assays and protein analysis. Plasmid DNA was purchased from Origene (Rockville, MD). ... Human IAPP, BACE2 and BACE1 proteins were detected using an anti-DDK monoclonal antibody (Origene). Also used were anti-hAPP 6E10 (Covance) and β-actin (Sigma ... Cite SaveSaving
FigureFigureFigure
WB
Showing 1-2 of 2 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products