OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

UBE2E2 (NM_152653) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204787
UBE2E2 (Myc-DDK-tagged)-Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA330518 Rabbit Polyclonal Anti-UBE2E2 Antibody
100 ul
$585.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "UBE2E2 or NM_152653"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol UBE2E2
Synonyms UBCH8
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204787 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACTGAGGCACAAAGAGTTGATGACAGTCCAAGCACTAGTGGAGGAAGTTCCGATGGAGATCAAC
GTGAAAGTGTTCAGCAAGAACCAGAAAGAGAACAAGTTCAGCCCAAGAAAAAGGAGGGAAAAATATCCAG
CAAAACCGCTGCTAAATTGTCAACTAGTGCTAAAAGAATTCAGAAGGAACTTGCAGAAATCACATTGGAC
CCTCCTCCCAACTGTAGTGCTGGACCCAAAGGAGACAACATTTATGAATGGAGGTCAACTATATTGGGAC
CCCCAGGATCTGTCTATGAAGGAGGGGTGTTCTTTCTTGACATTACCTTTTCACCAGACTATCCGTTTAA
ACCCCCTAAGGTTACCTTCCGAACAAGAATCTATCACTGTAATATTAACAGCCAAGGTGTGATCTGTCTG
GACATCTTAAAGGACAACTGGAGTCCGGCTTTAACTATTTCTAAAGTTCTCCTCTCCATCTGCTCACTTC
TTACAGATTGCAACCCTGCTGACCCTCTGGTGGGCAGCATCGCCACACAGTACATGACCAACAGAGCAGA
GCATGACCGGATGGCCAGACAGTGGACCAAGCGGTACGCCACA

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204787 protein sequence
Red=Cloning site Green=Tags(s)

MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTAAKLSTSAKRIQKELAEITLD
PPPNCSAGPKGDNIYEWRSTILGPPGSVYEGGVFFLDITFSPDYPFKPPKVTFRTRIYHCNINSQGVICL
DILKDNWSPALTISKVLLSICSLLTDCNPADPLVGSIATQYMTNRAEHDRMARQWTKRYAT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_152653
ORF Size 603 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_152653.4
RefSeq Size 1760 bp
RefSeq ORF 606 bp
Locus ID 7325
UniProt ID Q96LR5
Cytogenetics 3p24.3
Domains UBCc
Protein Pathways Ubiquitin mediated proteolysis
MW 22.3 kDa
Summary Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination. Catalyzes the ISGylation of influenza A virus NS1 protein.UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_152653" in other vectors (6)
SKU Description Size Price
RC204787L1 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2), Myc-DDK-tagged 10 ug
$600.00
RC204787L2 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2), mGFP tagged 10 ug
$600.00
RC204787L3 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2), Myc-DDK-tagged 10 ug
$600.00
RC204787L4 Lenti ORF clone of Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2), mGFP tagged 10 ug
$600.00
RG204787 UBE2E2 (tGFP-tagged) - Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2) 10 ug
$489.00 $500.00
SC319701 UBE2E2 (untagged)-Human ubiquitin-conjugating enzyme E2E 2 (UBE2E2) 10 ug
$300.00

Plasmid Map for RC204787

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204787
Circular map for RC204787

file-alt Citations

Cbl interacts with multiple E2s in vitro and in cells
Liyasova, Ma, Voeller et al
PLoS ONE (2019) 14 (5), e0216967 DOI: 10.1371/journal.pone.0216967
AI Summary: OriGene products, specifically the pCMV6 (PS10001), Ube2e1 (RC202106), Ube2e2 (RC204787), and Ube2e3 (RC200274) overexpression plasmids, were used to study the roles of different E2 enzymes in Cbl-mediated ubiquitination in HEK293T cells.
Snippet: pET15b-Ube2d2 was provided by Dr. Allan Weissman. Plasmids for overexpression in HEK293T cells were purchased from OriGene (Rockville, MD): pCMV6 (PS10001), Ube2e1 (RC202106), Ube2e2 (RC204787), Ube2e3 (RC200274) Cached;
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products