OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

WFDC5 (NM_145652) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204523
WFDC5 (Myc-DDK-tagged)-Human WAP four-disulfide core domain 5 (WFDC5)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA369473 WFDC5 rabbit polyclonal antibody
100 ul
$310.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "WFDC5 or NM_145652"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol WFDC5
Synonyms dJ211D12.5; PRG5; WAP1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204523 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGGACCCAGAGCCTTCTCCTCCTGGGGGCCCTCCTGGCTGTGGGGAGTCAGCTGCCTGCTGTCTTTG
GCAGGAAGAAGGGAGAGAAATCGGGGGGCTGCCCGCCAGATGATGGGCCCTGCCTCCTATCGGTGCCTGA
CCAGTGCGTGGAAGACAGCCAGTGTCCCTTGACCAGGAAGTGCTGCTACAGAGCTTGCTTCCGCCAGTGT
GTCCCCAGGGTCTCTGTGAAGCTGGGCAGCTGCCCAGAGGACCAACTGCGCTGCCTCAGCCCCATGAACC
ACCTGTGTCACAAGGACTCAGACTGCTCGGGCAAAAAGCGATGCTGCCACAGCGCCTGCGGGCGGGATTG
CCGGGATCCTGCCAGAGGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204523 protein sequence
Red=Cloning site Green=Tags(s)

MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQC
VPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_145652
ORF Size 369 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_145652.4
RefSeq Size 1018 bp
RefSeq ORF 372 bp
Locus ID 149708
UniProt ID Q8TCV5
Cytogenetics 20q13.12
Protein Families Secreted Protein
MW 13.3 kDa
Summary This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_145652" in other vectors (6)
SKU Description Size Price
RC204523L1 Lenti ORF clone of Human WAP four-disulfide core domain 5 (WFDC5), Myc-DDK-tagged 10 ug
$450.00
RC204523L2 Lenti ORF clone of Human WAP four-disulfide core domain 5 (WFDC5), mGFP tagged 10 ug
$450.00
RC204523L3 Lenti ORF clone of Human WAP four-disulfide core domain 5 (WFDC5), Myc-DDK-tagged 10 ug
$450.00
RC204523L4 Lenti ORF clone of Human WAP four-disulfide core domain 5 (WFDC5), mGFP tagged 10 ug
$450.00
RG204523 WFDC5 (tGFP-tagged) - Human WAP four-disulfide core domain 5 (WFDC5) 10 ug
$489.00
SC123230 WFDC5 (untagged)-Human WAP four-disulfide core domain 5 (WFDC5) 10 ug
$150.00

Plasmid Map for RC204523

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204523
Circular map for RC204523

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products