OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Claudin 2 (CLDN2) (NM_020384) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204199
CLDN2 (Myc-DDK-tagged)-Human claudin 2 (CLDN2), transcript variant 1
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $300.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA350681 Rabbit Polyclonal Anti-CLDN2 Antibody
100 ul
$205.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "Claudin 2 or NM_020384"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Claudin 2
Synonyms OAZON
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204199 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCTCTCTTGGCCTCCAACTTGTGGGCTACATCCTAGGCCTTCTGGGGCTTTTGGGCACACTGGTTG
CCATGCTGCTCCCCAGCTGGAAAACAAGTTCTTATGTCGGTGCCAGCATTGTGACAGCAGTTGGCTTCTC
CAAGGGCCTCTGGATGGAATGTGCCACACACAGCACAGGCATCACCCAGTGTGACATCTATAGCACCCTT
CTGGGCCTGCCCGCTGACATCCAGGCTGCCCAGGCCATGATGGTGACATCCAGTGCAATCTCCTCCCTGG
CCTGCATTATCTCTGTGGTGGGCATGAGATGCACAGTCTTCTGCCAGGAATCCCGAGCCAAAGACAGAGT
GGCGGTAGCAGGTGGAGTCTTTTTCATCCTTGGAGGCCTCCTGGGATTCATTCCTGTTGCCTGGAATCTT
CATGGGATCCTACGGGACTTCTACTCACCACTGGTGCCTGACAGCATGAAATTTGAGATTGGAGAGGCTC
TTTACTTGGGCATTATTTCTTCCCTGTTCTCCCTGATAGCTGGAATCATCCTCTGCTTTTCCTGCTCATC
CCAGAGAAATCGCTCCAACTACTACGATGCCTACCAAGCCCAACCTCTTGCCACAAGGAGCTCTCCAAGG
CCTGGTCAACCTCCCAAAGTCAAGAGTGAGTTCAATTCCTACAGCCTGACAGGGTATGTG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204199 protein sequence
Red=Cloning site Green=Tags(s)

MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTL
LGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNL
HGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPR
PGQPPKVKSEFNSYSLTGYV

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_020384
ORF Size 690 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_020384.4
RefSeq Size 2998 bp
RefSeq ORF 693 bp
Locus ID 9075
UniProt ID P57739
Cytogenetics Xq22.3
Protein Families Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
MW 24.5 kDa
Summary This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5' untranslated region have been found for this gene.provided by RefSeq, Jan 2010
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_020384" in other vectors (7)
SKU Description Size Price
RC204199L1 Lenti ORF clone of Human claudin 2 (CLDN2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204199L2 Lenti ORF clone of Human claudin 2 (CLDN2), transcript variant 1, mGFP tagged 10 ug
$600.00
RC204199L3 Lenti ORF clone of Human claudin 2 (CLDN2), transcript variant 1, Myc-DDK-tagged 10 ug
$600.00
RC204199L4 Lenti ORF clone of Human claudin 2 (CLDN2), transcript variant 1, mGFP tagged 10 ug
$600.00
RG204199 CLDN2 (tGFP-tagged) - Human claudin 2 (CLDN2), transcript variant 1 10 ug
$489.00 $500.00
SC304755 CLDN2 (untagged)-Human claudin 2 (CLDN2), transcript variant 1 10 ug
$330.00
SC320930 CLDN2 (untagged)-Human claudin 2 (CLDN2), transcript variant 1 10 ug
$300.00

Plasmid Map for RC204199

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204199
Circular map for RC204199

file-alt Citations

Vascular heterogeneity of tight junction Claudins guides organotropic metastasis
Zhou, LeBleu, Fletcher-Sananikone et al
Nat Cancer (2024) 5 (9), 1371-1389 DOI: 10.1038/s43018-024-00813-1
Cited by 11
AI Summary: In this study, OriGene's TurboGFP was used to stably label carcinoma epithelial cells, enabling their tracking and analysis during experiments investigating the mechanisms of organ-specific metastasis.
Snippet: carcinoma epithelial cells (Expasy RRID: CVCL 0125, from the Characterized Cell Line Core laboratory at MDACC), transduced to stably express TurboGFP (Origene,
Abstract 2627: Opposite functions of Claudin-2 involving Wnt signaling in liver cancer cells
Koga, Imamura, Nakamura et al
Tumor Biology (2020)
Snippet: gate molecular basis for the two-faced actions of CLDN-2 in liver cancer cells. _METHODS_: The human liver cancer cell lines Hep3B and HLF were used in this study. Plasmid-mediated _CLAUDIN-2_ cDNA (Origene) and lentivirus-mediated delivery of siRNA for _CLAUDIN-2_ (Santa Cruz) were utilized to generate stable overexpressing and knock-down (KD) cells, respectively. A cDNA microarray analysis and
Caveolin 1 is Associated with Upregulated Claudin 2 in Necrotizing Enterocolitis
Ares, Buonpane, Sincavage et al
Sci Rep (2019) 9 (1), 4982 DOI: 10.1038/s41598-019-41442-4
AI Summary: OriGene’s Claudin 2 (CLDN2) Human Tagged ORF Clone (catalog #RG204199) was used to transfect cells, enabling the study of claudin 2’s role in intestinal barrier dysfunction in necrotizing enterocolitis.
Snippet: Lipofectamine 2000 (LifeTech, Elmhurst, IL) was used to transfect with the plasmid: Claudin 2 (CLDN2) (NM_020384) Human Tagged ORF Clone, transcript variant 1 (Origene, Rockville, MD, # RG204199) for 72 hours followed by stable selection with gentamycin
FigureFigureFigure
IP
Showing 1-3 of 3 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products