OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GNB2 (NM_005273) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204178
GNB2 (Myc-DDK-tagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $457.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (6)

TA590202 Rabbit Polyclonal GNB2 Antibody
100 ug
$482.00
TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "GNB2 or NM_005273"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol GNB2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204178 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGTGAGCTGGAGCAACTGAGACAGGAGGCCGAGCAGCTCCGGAACCAGATCCGGGATGCCCGAAAAG
CATGTGGGGACTCAACACTGACCCAGATCACAGCTGGGCTGGACCCAGTGGGGAGAATCCAGATGAGGAC
CCGGAGGACCCTCCGTGGGCACCTGGCAAAGATCTATGCCATGCACTGGGGGACCGACTCAAGGCTGCTG
GTCAGCGCCTCCCAGGATGGGAAGCTCATCATCTGGGACAGCTACACCACCAACAAGGTCCACGCCATCC
CGCTGCGCTCCTCCTGGGTAATGACCTGTGCCTACGCGCCCTCAGGGAACTTTGTGGCCTGTGGGGGGTT
GGACAACATCTGCTCCATCTACAGCCTCAAGACCCGCGAGGGCAACGTCAGGGTCAGCCGGGAGCTGCCT
GGCCACACTGGGTACCTGTCGTGTTGCCGCTTCCTGGATGACAACCAAATCATCACCAGCTCTGGGGATA
CCACCTGTGCCCTGTGGGACATTGAGACAGGCCAGCAGACAGTGGGTTTTGCTGGACACAGTGGGGATGT
GATGTCCCTGTCCCTGGCCCCCGATGGCCGCACGTTTGTGTCAGGCGCCTGTGATGCCTCTATCAAGCTG
TGGGACGTGCGGGATTCCATGTGCCGACAGACCTTCATCGGCCATGAATCCGACATCAATGCAGTGGCTT
TCTTCCCCAACGGCTACGCCTTCACCACCGGCTCTGACGACGCCACGTGCCGCCTCTTCGACCTGCGGGC
CGATCAGGAGCTCCTCATGTACTCCCATGACAACATCATCTGTGGCATCACCTCTGTTGCCTTCTCGCGC
AGCGGACGGCTGCTGCTCGCTGGCTACGACGACTTCAACTGCAACATCTGGGATGCCATGAAGGGCGACC
GTGCAGGAGTCCTCGCTGGCCACGACAACCGCGTGAGCTGCCTTGGGGTCACCGACGATGGCATGGCTGT
GGCCACGGGCTCCTGGGACTCCTTCCTCAAGATCTGGAAC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204178 protein sequence
Red=Cloning site Green=Tags(s)

MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLL
VSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELP
GHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKL
WDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSR
SGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_005273
ORF Size 1020 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_005273.4
RefSeq Size 1681 bp
RefSeq ORF 1023 bp
Locus ID 2783
UniProt ID P62879, Q6FHM2
Cytogenetics 7q22.1
Domains WD40
Protein Pathways Chemokine signaling pathway
MW 37.3 kDa
Summary Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_005273" in other vectors (6)
SKU Description Size Price
RC204178L1 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2), Myc-DDK-tagged 10 ug
$757.00
RC204178L2 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2), mGFP tagged 10 ug
$757.00
RC204178L3 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2), Myc-DDK-tagged 10 ug
$757.00
RC204178L4 Lenti ORF clone of Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2), mGFP tagged 10 ug
$757.00
RG204178 GNB2 (tGFP-tagged) - Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2) 10 ug
$489.00 $657.00
SC319899 GNB2 (untagged)-Human guanine nucleotide binding protein (G protein), beta polypeptide 2 (GNB2) 10 ug
$457.00

Plasmid Map for RC204178

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204178
Circular map for RC204178

file-alt Citations

Quantitative proteomics reveals the roles of peroxisome-associated proteins in anti-viral innate immune responses
Zhou, Qin, Li et al
Mol. Cell Proteomics (2015)
AI Summary: OriGene’s human cDNA expression plasmids from their cDNA library were used to functionally analyze candidate peroxisome-associated proteins, enabling the identification of LGALS3BP and CALU as potential negative regulators of virus-induced type I interferon activation.
Snippet: 2) The candidate protein function was unknown or its previous reported function was unrelated to host immune responses. 3) The human cDNA expression plasmid is readily available in an Origene cDNA library. By following ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products