OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

ID4 (NM_001546) Human Tagged ORF Clone

  • Product Brand Image
Be the first to review this product
SKU
RC204170
ID4 (Myc-DDK-tagged)-Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4)
ORF Plasmid:
DDK tGFP
Lentiviral Particles:
DDK mGFP DDK w/ Puro mGFP w/ Puro
AAV Particle:
DDK
  $150.00
In Stock*
Bulk Requests & Clone Modifications

Frequently Bought Together (5)

TA592569S DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
30 ul
$200.00
CC100003 DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
5 x 200 ul
$170.00
PRIMER Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
100 pmol
$59.00
PS100001 pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
10 ug
$670.00
AR100028M DDKTrap Anti-DDK 8G6 affinity resin used for the purification of DDK, DYKDDDDK, or FLAG® tagged proteins , 5 mL
5 ml
$750.00

Other products for "ID4 or NM_001546"

Specifications
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol ID4
Synonyms bHLHb27; IDB4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC204170 representing NM_001546
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGGCGGTGAGCCCGGTGCGCCCCTCGGGCCGCAAGGCGCCGTCGGGCTGCGGCGGCGGGGAGCTGG
CGCTGCGCTGCCTGGCCGAGCACGGCCACAGCCTGGGTGGCTCCGCAGCCGCGGCGGCGGCGGCGGCGGC
AGCGCGCTGTAAGGCGGCCGAGGCGGCGGCCGACGAGCCGGCGCTGTGCCTGCAGTGCGATATGAACGAC
TGCTATAGCCGCCTGCGGAGGCTGGTGCCCACCATCCCGCCCAACAAGAAAGTCAGCAAAGTGGAGATCC
TGCAGCACGTTATCGACTACATCCTGGACCTGCAGCTGGCGCTGGAGACGCACCCGGCCCTGCTGAGGCA
GCCACCACCGCCCGCGCCGCCACACCACCCGGCCGGGACCTGTCCAGCCGCGCCGCCGCGGACCCCGCTC
ACTGCGCTCAACACCGACCCGGCCGGCGCGGTGAACAAGCAGGGCGACAGCATTCTGTGCCGC

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAGGTTTAA
Protein Sequence
>RC204170 representing NM_001546
Red=Cloning site Green=Tags(s)

MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMND
CYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPL
TALNTDPAGAVNKQGDSILCR

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene | Plasmid Map
ACCN NM_001546
ORF Size 483 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001546.4
RefSeq Size 2389 bp
RefSeq ORF 486 bp
Locus ID 3400
UniProt ID P47928
Cytogenetics 6p22.3
Domains HLH
Protein Families ES Cell Differentiation/IPS, Transcription Factors
Protein Pathways TGF-beta signaling pathway
MW 16.4 kDa
Summary This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis. provided by RefSeq, Aug 2017
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
"NM_001546" in other vectors (6)
SKU Description Size Price
RC204170L1 Lenti ORF clone of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4), Myc-DDK-tagged 10 ug
$450.00
RC204170L2 Lenti ORF clone of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4), mGFP tagged 10 ug
$450.00
RC204170L3 Lenti ORF clone of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4), Myc-DDK-tagged 10 ug
$450.00
RC204170L4 Lenti ORF clone of Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4), mGFP tagged 10 ug
$450.00
RG204170 ID4 (tGFP-tagged) - Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4) 10 ug
$350.00
SC127564 ID4 (untagged)-Human inhibitor of DNA binding 4, dominant negative helix-loop-helix protein (ID4) 10 ug
$150.00

Plasmid Map for RC204170

Download sequence for

file-download TXT (FASTA format)

file-download Genbank

Cloning scheme for RC204170
Circular map for RC204170

file-alt Citations

miRNA-342 regulates CEACAM1-induced lumen formation in a 3D model of mammary gland morphogenesis
Weng, Nguyen, Shively
J. Biol. Chem. (2016)
AI Summary: In this study, the pCMV6-ID4 plasmid from OriGene Technologies was used to investigate the role of ID4 in miRNA-342-regulated lumen formation in mammary gland morphogenesis.
Snippet: The LightSwitch 3'UTR Reporter GoClone for ID4 and miRNA inhibitors and control were from Active Motif (Carlsbad, CA). pCMV6-ID4 plasmid was obtained from OriGene Technologies, Inc (Rockville, MD). miRNA microarray. ... Cite SaveSaving
Showing 1-1 of 1 papers.
Powered by BizGenius
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products